Anti-MelanA antibody [OTI3E2] (ab140503)
Key features and details
- Mouse monoclonal [OTI3E2] to MelanA
- Suitable for: WB, IHC-P, ICC/IF
- Reacts with: Dog, Human, African green monkey
- Isotype: IgG1
Overview
-
Product name
Anti-MelanA antibody [OTI3E2]
See all MelanA primary antibodies -
Description
Mouse monoclonal [OTI3E2] to MelanA -
Host species
Mouse -
Tested Applications & Species
See all applications and species dataApplication Species ICC/IF African green monkeyIHC-P HumanWB DogHuman -
Immunogen
Recombinant full length protein corresponding to Human MelanA aa 1-118.
Sequence:MPREDAHFIYGYPKKGHGHSYTTAEEAAGIGILTVILGVLLLIGCWYCRR RNGYRALMDKSLHVGTQCALTRRCPQEGFDHRDSKVSLQEKNCEPVVPNA PPAYEKLSAEQSPPPYSP
-
Positive control
- WB: MDCK and HEK293T transfected with pCMV6-ENTRY MelanA cDNA cell lysate IHC-P: Human kidney and pancreas tissues ICC/IF: COS7 cells transiently transfected with pCMV6-ENTRY MelanA
-
General notes
The clone number has been updated from 3E2 to OTI3E2, both clone numbers name the same clone.
The Life Science industry has been in the grips of a reproducibility crisis for a number of years. Abcam is leading the way in addressing the problem with our range of recombinant monoclonal antibodies and knockout edited cell lines for gold-standard validation.
One factor contributing to the crisis is the use of antibodies that are not suitable. This can lead to misleading results and the use of incorrect data informing project assumptions and direction. To help address this challenge, we have introduced an application and species grid on our primary antibody datasheets to make it easy to simplify identification of the right antibody for your needs.
Learn more here.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid repeated freeze / thaw cycles. -
Storage buffer
pH: 7.30
Preservative: 0.02% Sodium azide
Constituents: 50% Glycerol, 1% BSA, PBS -
Concentration information loading...
-
Purity
Affinity purified -
Purification notes
Purified from cell culture supernatant by affinity chromatography -
Clonality
Monoclonal -
Clone number
OTI3E2 -
Isotype
IgG1 -
Research areas
Images
-
Immunohistochemical analysis of paraffin-embedded Human kidney tissue labelling MelanA with ab140503 at 1/150 dilution.
-
Immunofluorescent analysis of COS7 cells transiently transfected with pCMV6-ENTRY MelanA, labelling MelanA with ab140503 at 1/100 dilution.
-
Anti-MelanA antibody [OTI3E2] (ab140503) at 1/200 dilution + MDCK cell lysate at 10 µg
Predicted band size: 13 kDa
-
Immunohistochemical analysis of paraffin-embedded Human pancreas tissue labelling MelanA with ab140503 at 1/150 dilution.
-
All lanes : Anti-MelanA antibody [OTI3E2] (ab140503) at 1/4000 dilution
Lane 1 : HEK293T cell lysate transfected with pCMV6-ENTRY control
Lane 2 : HEK293T cell lysate transfected with pCMV6-ENTRY MelanA
Lysates/proteins at 5 µg per lane.
Predicted band size: 13 kDa