Anti-KPNA4 antibody (ab176585)
Key features and details
- Rabbit polyclonal to KPNA4
- Suitable for: WB, IP, IHC-P
- Reacts with: Human
- Isotype: IgG
Overview
-
Product name
Anti-KPNA4 antibody
See all KPNA4 primary antibodies -
Description
Rabbit polyclonal to KPNA4 -
Host species
Rabbit -
Tested applications
Suitable for: WB, IP, IHC-Pmore details -
Species reactivity
Reacts with: Human
Predicted to work with: Rabbit, Horse, Cow, Dog, Chimpanzee, Rhesus monkey, Gorilla, Chinese hamster, Orangutan -
Immunogen
Synthetic peptide within Human KPNA4 aa 471-521 (C terminal). The exact sequence is proprietary. (NP_002259.1).
Sequence:EDIYKLAYEIIDQFFSSDDIDEDPSLVPEAIQGGTFGFNSSANVPTEGFQ F
Database link: O00629 -
Positive control
- HeLa and 293T whole cell lysates; Human Ovarian Carcinoma and Prostate Carcinoma tissues.
-
General notes
The Life Science industry has been in the grips of a reproducibility crisis for a number of years. Abcam is leading the way in addressing this with our range of recombinant monoclonal antibodies and knockout edited cell lines for gold-standard validation. Please check that this product meets your needs before purchasing.
If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, along with publications, customer reviews and Q&As
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 6.8
Preservative: 0.09% Sodium azide
Constituents: 99% Tris buffered saline, 0.1% BSA -
Concentration information loading...
-
Purity
Immunogen affinity purified -
Purification notes
ab176585 was affinity purified using an epitope specific to KPNA4 immobilized on solid support. -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Images
-
All lanes : Anti-KPNA4 antibody (ab176585) at 0.04 µg/ml
Lane 1 : HeLa whole cell lysate at 50 µg
Lane 2 : HeLa whole cell lysate at 15 µg
Lane 3 : HeLa whole cell lysate at 5 µg
Lane 4 : 293T whole cell lysate at 50 µg
Developed using the ECL technique.
Predicted band size: 57 kDa
Exposure time: 3 seconds
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-KPNA4 antibody (ab176585)
Immunohistochemical analysis of formalin-fixed, paraffin-embedded Human prostate carcinoma tissue labeling KPNA4 with ab176585 at 1µg/ml.
-
Detection of KPNA4 in Immunoprecipitates of Jurkat whole cell lysate (1 mg for IP, 20% of IP loaded) using ab176585 at 3 µg/mg lysate for IP (Lane 1). For WB detection ab176585 was used at 0.4 µg/ml. Lane 2 represents control IgG IP.
Detection: Chemiluminescence with an exposure time of 0.5 seconds.