Anti-KCNMB3 antibody [N40B/18] (ab94590)
Key features and details
- Mouse monoclonal [N40B/18] to KCNMB3
- Suitable for: WB, IHC-P, ICC/IF
- Reacts with: Mouse, Rat, Human
- Isotype: IgG1
Overview
-
Product name
Anti-KCNMB3 antibody [N40B/18]
See all KCNMB3 primary antibodies -
Description
Mouse monoclonal [N40B/18] to KCNMB3 -
Host species
Mouse -
Specificity
No cross-reactivity against BKBeta1, BKBeta3b or BKBeta4. -
Tested Applications & Species
See all applications and species dataApplication Species ICC/IF HumanWB MouseRat -
Immunogen
Fusion protein corresponding to Mouse KCNMB3 aa 1-49 (N terminal). (unique N-terminus)
Sequence:MQPFSIPVQITLQGGRRRQGRTALPASGKINGDPLKVHPKLPSSAGEDR
-
Positive control
- WB: Rat brain membrane lysate. Lysate from COS-1 cells transiently transfected with KCNMB3a.
-
General notes
The clone number has been updated from S40B-18 to N40B/18, both clone numbers name the same antibody clone.
The Life Science industry has been in the grips of a reproducibility crisis for a number of years. Abcam is leading the way in addressing the problem with our range of recombinant monoclonal antibodies and knockout edited cell lines for gold-standard validation.
One factor contributing to the crisis is the use of antibodies that are not suitable. This can lead to misleading results and the use of incorrect data informing project assumptions and direction. To help address this challenge, we have introduced an application and species grid on our primary antibody datasheets to make it easy to simplify identification of the right antibody for your needs.
Learn more here.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at -20°C. Stable for 12 months at -20°C. -
Storage buffer
Preservative: 0.09% Sodium azide
Constituents: 50% Glycerol (glycerin, glycerine), PBS -
Concentration information loading... -
Purity
Protein G purified -
Clonality
Monoclonal -
Clone number
N40B/18 -
Isotype
IgG1 -
Research areas
Images
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-KCNMB3 antibody [N40B/18] (ab94590)Paraffin-embedded (Bouin’s Fixative) mouse back skin tissue stained for KCNMB3 with ab94590 at a 1/100 dilution (1 hour at RT) in immunohistochemical analysis.
Secondary Antibody: FITC Goat Anti-Mouse (green) at 1:50 for 1 hour at RT.
-
HaCaT (Human keratinocyte cell line) cells stained for KCNMB3 using ab94590 at a dilution of 1/100 in ICC/IF.
Cells were fixed in cold 100% methanol for 10 minutes at -20°C. Incubated with primary antibody for 1 hour at RT. Secondary Antibody: FITC Goat Anti-Mouse (green) at 1:50 for 1 hour at RT.
-
Anti-KCNMB3 antibody [N40B/18] (ab94590) at 1/1000 dilution + Rat brain membrane lysate at 15 µg
Secondary
Sheep Anti-Mouse IgG: HRP
Predicted band size: 32 kDaBlock: 1.5% BSA for 30 minutes at RT.
Incubated with primary antibody for 2 hours at RT.
Incubated with secondary antibody for 1 hour at RT.

