Anti-ISCU antibody [OTI4F5] (ab180532)
![Anti-ISCU antibody [OTI4F5] (ab180532)](https://www.abcam.com/ps/products/180/ab180532/Images/ab180532-209218-ab180532WB.jpg "Anti-ISCU antibody [OTI4F5] (ab180532)")
Key features and details
- Mouse monoclonal [OTI4F5] to ISCU
- Suitable for: IHC-P, WB
- Reacts with: Human
- Isotype: IgG1
Overview
-
Product name
Anti-ISCU antibody [OTI4F5]
See all ISCU primary antibodies -
Description
Mouse monoclonal [OTI4F5] to ISCU -
Host species
Mouse -
Tested applications
Suitable for: IHC-P, WBmore details -
Species reactivity
Reacts with: Human
Predicted to work with: Mouse
-
Immunogen
Recombinant full length protein corresponding to Human ISCU aa 1-142. Produced in E.coli. (NP_055116)
Sequence:MVLIDMSVDLSTQVVDHYENPRNVGSLDKTSKNVGTGLVGAPACGDVMKL QIQVDEKGKIVDARFKTFGCGSAIASSSLATEWVKGKTVEEALTIKNTDI AKELCLPPVKLHCSMLAEDAIKAALADYKLKQEPKKGEAEKK
Database link: Q9H1K1-2 -
Positive control
- WB: HEK-293T cell lysate transfected with pCMV6-ENTRY ISCU cDNA. IHC-P: Human pancreas carcinoma, thyroid carcinoma and lymphoma tissue.
-
General notes
Clone OTI4F5 (formerly 4F5).
The Life Science industry has been in the grips of a reproducibility crisis for a number of years. Abcam is leading the way in addressing this with our range of recombinant monoclonal antibodies and knockout edited cell lines for gold-standard validation. Please check that this product meets your needs before purchasing.
If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, along with publications, customer reviews and Q&As
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.30
Preservative: 0.02% Sodium azide
Constituents: PBS, 50% Glycerol, 1% BSA -
Concentration information loading... -
Purity
Affinity purified -
Purification notes
Purified from cell culture supernatant by affinity chromatography. -
Clonality
Monoclonal -
Clone number
OTI4F5 -
Isotype
IgG1 -
Research areas
Images
-
Western blot - Anti-ISCU antibody [OTI4F5] (ab180532)All lanes : Anti-ISCU antibody [OTI4F5] (ab180532) at 1/2000 dilution
Lane 1 : HEK-293T (Human epithelial cell line from embryonic kidney transformed with large T antigen) cell lysate transfected with pCMV6-ENTRY control cDNA for 48 hrs
Lane 2 : HEK-293T cell lysate transfected with the pCMV6-ENTRY ISCU cDNA for 48 hrs
Lysates/proteins at 5 µg per lane.
Developed using the ECL technique.
Predicted band size: 15 kDa
-
![Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-ISCU antibody [OTI4F5] (ab180532)](https://www.abcam.com/ps/products/180/ab180532/Images/ab180532-209221-ab180532IHC3.jpg)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-ISCU antibody [OTI4F5] (ab180532)Paraffin-embedded human lymphoma tissue stained for ISCU with ab180532 at a 1/150 dilution in immunohistochemical analysis. Heat-induced epitope retrieval by 10 mM citric buffer, pH 6.0, 120°C for 3 minutes.
-
![Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-ISCU antibody [OTI4F5] (ab180532)](https://www.abcam.com/ps/products/180/ab180532/Images/ab180532-209220-ab180532IHC2.jpg)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-ISCU antibody [OTI4F5] (ab180532)Paraffin-embedded human thyroid carcinoma tissue stained for ISCU with ab180532 at a 1/150 dilution in immunohistochemical analysis. Heat-induced epitope retrieval by 10 mM citric buffer, pH 6.0, 120°C for 3 minutes.
-
![Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-ISCU antibody [OTI4F5] (ab180532)](https://www.abcam.com/ps/products/180/ab180532/Images/ab180532-209219-ab180532IHC1.jpg)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-ISCU antibody [OTI4F5] (ab180532)Paraffin-embedded human pancreas carcinoma tissue stained for ISCU with ab180532 at a 1/150 dilution in immunohistochemical analysis. Heat-induced epitope retrieval by 10 mM citric buffer, pH 6.0, 120°C for 3 minutes.
