Call: +7 771 977 66 65, +7 705 421 2277
Sign in or Register
My basket

Astana Biomed Group, an authorized Abcam distributor in Central Asia

Abiomed homepage

  • Categories
    Signal Transduction
    Cancer
    Epigenetics and Nuclear Signaling
    Immunology
    Cell Biology
    Cardiovascular
    Neuroscience
    Tags & Cell Markers
    Kits/ Lysates/ Other
    Developmental Biology
    Microbiology
    Biochemicals
    Secondary antibodies
    Isotype/Loading Controls
    Antibody Arrays
  • About us
  • Partners
  • Contact
    Address

    Saryarka 32, 18, 010000, Astana city, Kazakhstan

    Telephone +7 771 977 66 65, +7 705 421 2277

    Email

    laboratory@ctlab.kz, orders@abiomed.kz

Back to category
Cardiovascular Blood Coagulation Extrinsic

Anti-HNF-4-alpha antibody [K9218] (ab41898)

Price and availability

335 040 ₸

Availability

Order now and get it on Tuesday March 02, 2021

Anti-HNF-4-alpha antibody [K9218] (ab41898)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)

Key features and details

  • Mouse monoclonal [K9218] to HNF-4-alpha
  • Suitable for: WB, IHC-P, ICC/IF, Flow Cyt
  • Reacts with: Rat, Human
  • Isotype: IgG2a

You may also be interested in

Product image
Anti-Tissue Factor antibody (ab182783)
Product image
Anti-Tissue Factor antibody [EPR22548-240] - BSA and Azide free (ab254007)
Product image
Alexa Fluor® 488 Anti-HNF-4-alpha antibody [EPR3648] (ab216897)
Product image
Anti-Factor Xa Heavy Chain antibody (ab180701)

Overview

  • Product name

    Anti-HNF-4-alpha antibody [K9218]
    See all HNF-4-alpha primary antibodies
  • Description

    Mouse monoclonal [K9218] to HNF-4-alpha
  • Host species

    Mouse
  • Tested Applications & Species

    Application Species
    Flow Cyt
    Human
    ICC/IF
    Human
    IHC-P
    Rat
    Human
    WB
    Human
    See all applications and species data
  • Immunogen

    Recombinant fragment corresponding to Human HNF-4-alpha aa 3-49.
    Sequence:

    MADYSAALDPAYTTLEFENVQVLTMGNDTSPSEGTNLNAPNSLGVSAL

    Run BLAST with BLAST the sequence with ExPASy Run BLAST with BLAST the sequence with NCBI
  • Positive control

    • Human liver hepatocytes and rat intestine epithelial cell.
  • General notes

    This product was changed from ascites to tissue culture supernatant on 3rd April 2019. Please note that the dilutions may need to be adjusted accordingly. If you have any questions, please do not hesitate to contact our scientific support team.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7
    Preservative: 0.1% Sodium azide

    Physiological saline.
  • Concentration information loading...
  • Purity

    Tissue culture supernatant
  • Clonality

    Monoclonal
  • Clone number

    K9218
  • Isotype

    IgG2a
  • Research areas

    • Cardiovascular
    • Blood
    • Coagulation
    • Extrinsic
    • Cardiovascular
    • Lipids / Lipoproteins
    • Lipid Metabolism
    • Cholesterol Metabolism
    • Cardiovascular
    • Lipids / Lipoproteins
    • Lipid Metabolism
    • Cytochromes
    • Signal Transduction
    • Metabolism
    • Energy Metabolism
    • Epigenetics and Nuclear Signaling
    • Transcription
    • Polymerase associated factors
    • Pol II Transcription
    • Other
    • Cardiovascular
    • Atherosclerosis
    • Diabetes associated
    • Developmental Biology
    • Organogenesis
    • Gut development
    • Liver development
    • Cancer
    • Cancer Metabolism
    • Metabolic signaling pathway
    • Metabolism of lipids and lipoproteins
    • Metabolism
    • Pathways and Processes
    • Metabolic signaling pathways
    • Lipid and lipoprotein metabolism
    • Lipid metabolism
    • Metabolism
    • Pathways and Processes
    • Metabolic signaling pathways
    • Lipid and lipoprotein metabolism
    • Cholesterol Metabolism
    • Metabolism
    • Pathways and Processes
    • Metabolic signaling pathways
    • Lipid and lipoprotein metabolism
    • Lipases
    • Metabolism
    • Pathways and Processes
    • Metabolic signaling pathways
    • Energy transfer pathways
    • Energy Metabolism
    • Metabolism
    • Pathways and Processes
    • Mitochondrial Metabolism
    • Cytochromes
    • Metabolism
    • Types of disease
    • Diabetes
    • Metabolism
    • Types of disease
    • Cancer
    • Metabolism
    • Types of disease
    • Heart disease

Images

  • Western blot - Anti-HNF-4-alpha antibody [K9218] (ab41898)
    Western blot - Anti-HNF-4-alpha antibody [K9218] (ab41898)
    Anti-HNF-4-alpha antibody [K9218] (ab41898) at 1 µg/ml + HepG2 (Human hepatocellular liver carcinoma cell line) Whole Cell Lysate at 10 µg

    Secondary
    Goat Anti-Mouse IgG H&L (HRP) preadsorbed (ab97040) at 1/5000 dilution

    Developed using the ECL technique.

    Performed under reducing conditions.

    Predicted band size: 53 kDa
    Observed band size: 53 kDa
    Additional bands at: 108 kDa, 37 kDa. We are unsure as to the identity of these extra bands.


    Exposure time: 4 minutes


    This image was generated using the ascites version of the product.

  • Immunocytochemistry/ Immunofluorescence - Anti-HNF-4-alpha antibody [K9218] (ab41898)
    Immunocytochemistry/ Immunofluorescence - Anti-HNF-4-alpha antibody [K9218] (ab41898)

    ICC/IF image of ab41898 stained HepG2 cells. The cells were 4% PFA fixed (10 min) and then incubated in 1%BSA / 10% normal goat serum / 0.3M glycine in 0.1% PBS-Tween for 1h to permeabilise the cells and block non-specific protein-protein interactions. The cells were then incubated with the antibody (ab41898, 1µg/ml) overnight at +4°C. The secondary antibody (green) was Alexa Fluor® 488 goat anti-mouse IgG (H+L) (ab150113) used at a 1/1000 dilution for 1h. Alexa Fluor® 594 WGA was used to label plasma membranes (red) at a 1/200 dilution for 1h. DAPI was used to stain the cell nuclei (blue) at a concentration of 1.43µM.

    This image was generated using the ascites version of the product.

  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-HNF-4-alpha antibody [K9218] (ab41898)
    Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-HNF-4-alpha antibody [K9218] (ab41898) Image from Algamas-Dimantov A et al., J Lipid Res. 2012 Jun;53(6):1056-70. doi: 10.1194/jlr.M021949. Epub 2012 Feb 22. Fig 5.; The Journal of Lipid Research, June 2012, vol. 53 no. 6 1056-1070

    Immunohistochemical analysis of obese mouse colon tissue, staining HNF-4-alpha with ab41898 at 1/200 dilution.

    This image was generated using the ascites version of the product.

  • Flow Cytometry - Anti-HNF-4-alpha antibody [K9218] (ab41898)
    Flow Cytometry - Anti-HNF-4-alpha antibody [K9218] (ab41898)

    Overlay histogram showing HepG2 cells stained with ab41898 (red line). The cells were fixed with methanol (5 min) and then permeabilized with 0.1% PBS-Tween for 20 min. The cells were then incubated in 1x PBS / 10% normal goat serum (ab7481) / 0.3M glycine to block non-specific protein-protein interactions followed by the antibody (ab41898, 2µg/1x106 cells) for 30 min at 22°C. The secondary antibody used was DyLight® 488 goat anti-mouse IgG (H+L) (ab96879) at 1/500 dilution for 30 min at 22°C. Isotype control antibody (black line) was mouse IgG2a [ICIGG2A] (ab91361, 2µg/1x106 cells) used under the same conditions. Acquisition of >5,000 events was performed. This antibody gave a significantly decreased signal in HepG2 cells fixed with 4% paraformaldehyde/permeabilized in 0.1% PBS-Tween used under the same conditions.

    This image was generated using the ascites version of the product.

  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-HNF-4-alpha antibody [K9218] (ab41898)
    Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-HNF-4-alpha antibody [K9218] (ab41898)

    ab41898 staining HNF-4-alpha in human liver hepatocytes (10-20 ug/mL) by Immunohistochemistry, formalin-fixed paraffin embedded sections.

    This image was generated using the ascites version of the product.

  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-HNF-4-alpha antibody [K9218] (ab41898)
    Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-HNF-4-alpha antibody [K9218] (ab41898)

    ab41898 staining HNF-4-alpha in Rat Intestine epithelial cell(10-20 ug/mL) by Immunohistochemistry, formalin-fixed paraffin embedded sections.

    This image was generated using the ascites version of the product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Alternative products to Anti-HNF-4-alpha antibody [K9218] (ab41898)

  •  
  • Product image

    Alexa Fluor® 647 Anti-HNF-4-alpha antibody [EPR3648] (ab217073)

    Applications: ICC/IF

  •  
  • Product image

    Anti-HNF-4-alpha antibody [EPR16885] - ChIP Grade (ab181604)

    Applications: ChIP, IHC-P, IP, WB

  •  
  • Product image

    Anti-HNF-4-alpha antibody [EPR19265-130] - ChIP Grade (ab200142)

    Applications: ChIP, Flow Cyt, ICC/IF, IP, WB

  •  
  • Product image

    Anti-HNF-4-alpha antibody [EPR16885-99] (ab201460)

    Applications: Flow Cyt, ICC/IF, IHC-P, WB

  •  
  • Product image

    Anti-HNF-4-alpha antibody [EPR3648] (ab92378)

    Applications: Flow Cyt, ICC/IF, IHC-P, WB

  •  
  • Product image

    Anti-HNF-4-alpha antibody [EPR16885-99] - BSA and Azide free (ab231167)

    Applications: Flow Cyt, ICC/IF, IHC-P, WB

  •  
  • Product image

    Anti-HNF-4-alpha antibody [EPR16786] - N-terminal (ab199431)

    Applications: ICC/IF, IHC-P, WB

Get resources and offers direct to your inbox Sign up
© 2021 Astana Biomed Group LLP. All rights reserved.