Anti-Exonuclease 1 antibody (ab95012)
Key features and details
- Rabbit polyclonal to Exonuclease 1
- Suitable for: WB, IP
- Reacts with: Human
- Isotype: IgG
Overview
-
Product name
Anti-Exonuclease 1 antibody
See all Exonuclease 1 primary antibodies -
Description
Rabbit polyclonal to Exonuclease 1 -
Host species
Rabbit -
Tested Applications & Species
See all applications and species dataApplication Species IP HumanWB Human -
Immunogen
Immunogen maps to a region within:
LSHFSKKDTPLRNKVPGLYKSSSADSLSTTKIKPLGPARASGLSKKPASI QK
, corresponding to amino acids 725-775 of Human Exonuclease 1 (NP_006018.4). -
Positive control
- HeLa and 293T whole cell lysate
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles. -
Storage buffer
pH: 7
Preservative: 0.09% Sodium azide
Constituent: Tris citrate/phosphate -
Concentration information loading... -
Purity
Immunogen affinity purified -
Purification notes
ab95012 was affinity purified using an epitope specific to Exonuclease 1 immobilized on solid support. -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Images
-
All lanes : Anti-Exonuclease 1 antibody (ab95012) at 0.1 µg/ml
Lane 1 : HeLa whole cell lysate at 50 µg
Lane 2 : HeLa whole cell lysate at 15 µg
Lane 3 : HeLa whole cell lysate at 5 µg
Lane 4 : 293T whole cell lysate at 50 µg
Developed using the ECL technique.
Predicted band size: 94 kDa
Exposure time: 30 seconds
-
ab95012 at 1 µg/ml detecting Exonuclease 1 in HeLa whole cell lysate by WB following IP.
Lane 1: ab95012 with 10µg/mg of lysate
Lane 2: IP with an antibody which recognizes an downstream epitope of Exonuclease 1
Lane 3: control IgG.
In each case, 1 mg of lysate was used for IP and 20% of the IP was loaded.
Detection: Chemiluminescence with an exposure time of 30 seconds

