Anti-EVL antibody (ab204835)
Key features and details
- Rabbit polyclonal to EVL
- Suitable for: IHC-P, ICC/IF, WB
- Reacts with: Human
- Isotype: IgG
Overview
-
Product name
Anti-EVL antibody -
Description
Rabbit polyclonal to EVL -
Host species
Rabbit -
Tested applications
Suitable for: IHC-P, ICC/IF, WBmore details -
Species reactivity
Reacts with: Human
Predicted to work with: Mouse, Rat
-
Immunogen
Recombinant fragment corresponding to Human EVL.
Sequence:SNSVEKPVSSILSRMKPAGSVNDMALDAFDLDRMKQEILEEVVRELHKVK EEIIDAIRQELSGI
-
Positive control
- Human tonsil tissue; U-2 OS cells.
-
General notes
This product was previously labelled as Enah/Vasp-like
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.20
Preservative: 0.02% Sodium azide
Constituents: 59% PBS, 40% Glycerol (glycerin, glycerine) -
Concentration information loading... -
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Images
-
Immunohistochemical analysis of paraffin-embedded Human small intestine tissue labeling EVL with ab204835 at 1/1000 dilution.
-
Immunohistochemical analysis of paraffin-embedded Human lymph node tissue labeling EVL with ab204835 at 1/1000 dilution.
-
Immunohistochemical analysis of paraffin-embedded human lung tissue labeling EVL with ab204835 at 1/1000 dilution.
-
Negative control: Immunohistochemical analysis of paraffin-embedded Human skeletal muscle tissue labeling EVL with ab204835 at 1/1000 dilution.
-
Negative control: Immunohistochemical analysis of paraffin-embedded Human kidney tissue labeling EVL with ab204835 at 1/1000 dilution.
-
Immunohistochemical analysis of paraffin-embedded Human tonsil tissue labeling EVL with ab204835 at 1/1000 dilution.
-
Immunofluorescent analysis of PFA- fixed, Triton X-100 permeabilized U-2 OS cells labeling EVL with ab204835 at 4 µg/ml (green).
-
Anti-EVL antibody (ab204835) + MOLT-4
Secondary
EVL
Predicted band size: 40 kDa
Observed band size: 55 kDa why is the actual band size different from the predicted?

