Call: +7 771 977 66 65, +7 705 421 2277
Sign in or Register
My basket

Astana Biomed Group, an authorized Abcam distributor in Central Asia

Abiomed homepage

  • Categories
    Signal Transduction
    Cancer
    Epigenetics and Nuclear Signaling
    Immunology
    Cell Biology
    Cardiovascular
    Neuroscience
    Tags & Cell Markers
    Kits/ Lysates/ Other
    Developmental Biology
    Microbiology
    Biochemicals
    Secondary antibodies
    Isotype/Loading Controls
    Antibody Arrays
  • About us
  • Partners
  • Contact
    Address

    Saryarka 32, 18, 010000, Astana city, Kazakhstan

    Telephone +7 771 977 66 65, +7 705 421 2277

    Email

    laboratory@ctlab.kz, orders@abiomed.kz

Back to category
Signal Transduction Cytoskeleton / ECM Cytoskeleton Microfilaments Actin etc Actin Assembly

Anti-EVL antibody (ab204835)

Anti-EVL antibody (ab204835)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)

Key features and details

  • Rabbit polyclonal to EVL
  • Suitable for: IHC-P, ICC/IF, WB
  • Reacts with: Human
  • Isotype: IgG

You may also be interested in

Product image
Thymosin beta 4 overexpression 293T lysate (whole cell) (ab225677)
Product image
Recombinant Human Cortactin protein (ab131824)
Product image
Anti-D4 GDI antibody (ab226350)
Product image
Anti-PDLIM7 antibody (ab86065)

Overview

  • Product name

    Anti-EVL antibody
  • Description

    Rabbit polyclonal to EVL
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, ICC/IF, WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat
  • Immunogen

    Recombinant fragment corresponding to Human EVL.
    Sequence:

    SNSVEKPVSSILSRMKPAGSVNDMALDAFDLDRMKQEILEEVVRELHKVK EEIIDAIRQELSGI

    Run BLAST with BLAST the sequence with ExPASy Run BLAST with BLAST the sequence with NCBI
  • Positive control

    • Human tonsil tissue; U-2 OS cells.
  • General notes

     This product was previously labelled as Enah/Vasp-like

     

    Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.

    Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.

    We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.

    In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.

    We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.

    Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.

    Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.20
    Preservative: 0.02% Sodium azide
    Constituents: 59% PBS, 40% Glycerol (glycerin, glycerine)
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

    • Signal Transduction
    • Cytoskeleton / ECM
    • Cytoskeleton
    • Microfilaments
    • Actin etc
    • Actin Assembly

Images

  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-EVL antibody (ab204835)
    Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-EVL antibody (ab204835)

    Immunohistochemical analysis of paraffin-embedded Human small intestine tissue labeling EVL with ab204835 at 1/1000 dilution.

  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-EVL antibody (ab204835)
    Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-EVL antibody (ab204835)

    Immunohistochemical analysis of paraffin-embedded Human lymph node tissue labeling EVL with ab204835 at 1/1000 dilution.

  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-EVL antibody (ab204835)
    Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-EVL antibody (ab204835)

    Immunohistochemical analysis of paraffin-embedded human lung tissue labeling EVL with ab204835 at 1/1000 dilution.

  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-EVL antibody (ab204835)
    Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-EVL antibody (ab204835)

    Negative control: Immunohistochemical analysis of paraffin-embedded Human skeletal muscle tissue labeling EVL with ab204835 at 1/1000 dilution.

  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-EVL antibody (ab204835)
    Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-EVL antibody (ab204835)

    Negative control: Immunohistochemical analysis of paraffin-embedded Human kidney tissue labeling EVL with ab204835 at 1/1000 dilution.

  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-EVL antibody (ab204835)
    Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-EVL antibody (ab204835)

    Immunohistochemical analysis of paraffin-embedded Human tonsil tissue labeling EVL with ab204835 at 1/1000 dilution.

  • Immunocytochemistry/ Immunofluorescence - Anti-EVL antibody (ab204835)
    Immunocytochemistry/ Immunofluorescence - Anti-EVL antibody (ab204835)

    Immunofluorescent analysis of PFA- fixed, Triton X-100 permeabilized U-2 OS cells labeling EVL with ab204835 at 4 µg/ml (green).

  • Western blot - Anti-EVL antibody (ab204835)
    Western blot - Anti-EVL antibody (ab204835)
    Anti-EVL antibody (ab204835) + MOLT-4

    Secondary
    EVL

    Predicted band size: 40 kDa
    Observed band size: 55 kDa
    why is the actual band size different from the predicted?

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Clear all

Recently viewed products

  •  
  • Product image

    Human Insulin ELISA Kit (ab278123)

  •  
  • Product image

    Anti-FOXN2 antibody (ab225954)

  •  
  • Product image

    Recombinant Human Hepcidin protein (ab132374)

Get resources and offers direct to your inbox Sign up
© 2021 Astana Biomed Group LLP. All rights reserved.