Anti-EVI1 antibody (ab28457)
Key features and details
- Rabbit polyclonal to EVI1
- Suitable for: IHC-P, WB
- Reacts with: Human
- Isotype: IgG
Overview
-
Product name
Anti-EVI1 antibody
See all EVI1 primary antibodies -
Description
Rabbit polyclonal to EVI1 -
Host species
Rabbit -
Tested applications
Suitable for: IHC-P, WBmore details -
Species reactivity
Reacts with: Human
Predicted to work with: Rat, Rabbit, Horse, Chicken, Guinea pig, Cow, Cat, Dog
-
Immunogen
Synthetic peptide within Human EVI1 aa 964-1013 (C terminal). The exact sequence is proprietary.
Sequence:HFTDSLKMRKMEDNQYSEAELSSFSTSHVPEELKQPLHRKSKSQAYAMML
Database link: Q03112 -
Positive control
- WB: 293T cell lysate. IHC-P: Human intestine tissue.
-
General notes
The Life Science industry has been in the grips of a reproducibility crisis for a number of years. Abcam is leading the way in addressing the problem with our range of recombinant monoclonal antibodies and knockout edited cell lines for gold-standard validation.
One factor contributing to the crisis is the use of antibodies that are not suitable. This can lead to misleading results and the use of incorrect data informing project assumptions and direction. To help address this challenge, we have introduced an application and species grid on our primary antibody datasheets to make it easy to simplify identification of the right antibody for your needs.
Learn more here.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.2
Preservative: 0.09% Sodium azide
Constituents: 2% Sucrose, PBS -
Concentration information loading... -
Purity
Immunogen affinity purified -
Purification notes
Ab28457 was purified by peptide affinity chromatography method. -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Images
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-EVI1 antibody (ab28457)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) analysis of human intestine tissue labelling EVI1 with ab28457 at 4-8µg/ml. Cells with positive label: epithelial cells of intestinal villus (indicated with arrows). Magnification: 400X.
-
Western blot - Anti-EVI1 antibody (ab28457)Anti-EVI1 antibody (ab28457) at 1 µg/ml + 293T cell lysate at 10 µg
Predicted band size: 118 kDa