Call: +7 771 977 66 65, +7 705 421 2277
Sign in or Register
My basket

Astana Biomed Group, an authorized Abcam distributor in Central Asia

Abiomed homepage

  • Categories
    Signal Transduction
    Cancer
    Epigenetics and Nuclear Signaling
    Immunology
    Cell Biology
    Cardiovascular
    Neuroscience
    Tags & Cell Markers
    Kits/ Lysates/ Other
    Developmental Biology
    Microbiology
    Biochemicals
    Secondary antibodies
    Isotype/Loading Controls
    Antibody Arrays
  • About us
  • Partners
  • Contact
    Address

    Saryarka 32, 18, 010000, Astana city, Kazakhstan

    Telephone +7 771 977 66 65, +7 705 421 2277

    Email

    laboratory@ctlab.kz, orders@abiomed.kz

Back to category
Epigenetics and Nuclear Signaling Transcription Domain Families Zinc Finger

Anti-Estrogen Related Receptor alpha antibody (ab137489)

Price and availability

284 784 ₸

Availability

Order now and get it on Wednesday February 24, 2021

Anti-Estrogen Related Receptor alpha antibody (ab137489)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)

Key features and details

  • Rabbit polyclonal to Estrogen Related Receptor alpha
  • Suitable for: ChIP, IHC-P, IP, WB
  • Reacts with: Mouse, Rat, Human
  • Isotype: IgG

You may also be interested in

Product image
Anti-OVOL2 antibody [PCRP-OVOL2-2A1] - BSA and Azide free (ab277110)
Product image
Human ZMYM3 knockout HeLa cell lysate (ab258768)
Product image
Anti-KLHL12 antibody (ab203880)
Product image
Recombinant Human ZNF22 protein (ab172167)

Overview

  • Product name

    Anti-Estrogen Related Receptor alpha antibody
    See all Estrogen Related Receptor alpha primary antibodies
  • Description

    Rabbit polyclonal to Estrogen Related Receptor alpha
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ChIP, IHC-P, IP, WBmore details
  • Species reactivity

    Reacts with: Mouse, Rat, Human
    Predicted to work with: Cow, Dog, Pig
  • Immunogen

    Synthetic peptide corresponding to Human Estrogen Related Receptor alpha aa 1-45 (N terminal).
    Sequence:

    MSSQVVGIEPLYIKAEPASPDSPKGSSETETEPPVALAPGPAPTR


    Database link: P11474
    Run BLAST with BLAST the sequence with ExPASy Run BLAST with BLAST the sequence with NCBI
  • General notes

    Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.

    Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.

    We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.

    In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.

    We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.

    Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.

    Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.00
    Preservative: 0.01% Thimerosal (merthiolate)
    Constituents: 1.21% Tris, 0.75% Glycine, 10% Glycerol (glycerin, glycerine)
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

    • Epigenetics and Nuclear Signaling
    • Transcription
    • Domain Families
    • Zinc Finger
    • Signal Transduction
    • Signaling Pathway
    • Nuclear Signaling
    • Nuclear Hormone Receptors
    • Estrogen
    • Epigenetics and Nuclear Signaling
    • Nuclear Signaling Pathways
    • Nuclear Receptors
    • Estrogen
    • Cancer
    • Signal transduction
    • Nuclear signaling
    • Nuclear hormone receptors
    • Estrogen
    • Metabolism
    • Pathways and Processes
    • Mitochondrial Metabolism
    • Mitochondrial Biogenesis
    • Metabolism
    • Pathways and Processes
    • Metabolic signaling pathways
    • Nucleotide metabolism
    • Molecular processes
    • Mitochondrial transcription

Images

  • Western blot - Anti-Estrogen Related Receptor alpha antibody (ab137489)
    Western blot - Anti-Estrogen Related Receptor alpha antibody (ab137489)
    Anti-Estrogen Related Receptor alpha antibody (ab137489) at 1/500 dilution + Neuro2A whole cell extract at 30 µg

    Predicted band size: 46 kDa



    10% SDS-PAGE

  • Western blot - Anti-Estrogen Related Receptor alpha antibody (ab137489)
    Western blot - Anti-Estrogen Related Receptor alpha antibody (ab137489)
    Anti-Estrogen Related Receptor alpha antibody (ab137489) at 1/500 dilution + Rat2 whole cell extract at 30 µg

    Predicted band size: 46 kDa



    10% SDS-PAGE

  • ChIP - Anti-Estrogen Related Receptor alpha antibody (ab137489)
    ChIP - Anti-Estrogen Related Receptor alpha antibody (ab137489)

    Cross-linked ChIP was performed with MCF-7 chromatin extract and 5 μg of either control rabbit IgG or anti-ERR alpha antibody. The precipitated DNA was detected by PCR with primer set targeting to PS2 promoter or GAPDH promoter.

  • Immunoprecipitation - Anti-Estrogen Related Receptor alpha antibody (ab137489)
    Immunoprecipitation - Anti-Estrogen Related Receptor alpha antibody (ab137489)

    ERR alpha was immunoprecipitated from 40µ of HEK-293T whole cell lysate with ab137489 at 1/1000 dilution. Secondary antibody EasyBlot anti-rabbit IgG was used as secondary antibody.
    Lane 1: 40 μg HEK-293T whole cell lysate.
    Lane 2: Control with 2 μg of preimmune rabbit IgG. 
    Lane 3: Immunoprecipitation of ERR alpha protein by 2 μg of ERR alpha antibody.

    7.5% SDS-PAGE

  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Estrogen Related Receptor alpha antibody (ab137489)
    Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Estrogen Related Receptor alpha antibody (ab137489)

    Paraffin embedded mouse heart tissue stained for ERR alpha using ab137489 at 1/500 dilution in immunohistochemical analysis.

  • Western blot - Anti-Estrogen Related Receptor alpha antibody - N-terminal (ab137489)
    Western blot - Anti-Estrogen Related Receptor alpha antibody - N-terminal (ab137489)
    All lanes : Anti-Estrogen Related Receptor alpha antibody (ab137489) at 1/500 dilution

    Lane 1 : 293T whole cell lysate
    Lane 2 : A431 whole cell lysate
    Lane 3 : H1299 whole cell lysate

    Lysates/proteins at 30 µg per lane.

    Predicted band size: 46 kDa



    12% SDS PAGE

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Alternative products to Anti-Estrogen Related Receptor alpha antibody (ab137489)

  •  
  • Product image

    Anti-Estrogen Related Receptor alpha antibody [EPR46Y] (ab76228)

    Applications: IP, WB

  •  
  • Product image

    Anti-Estrogen Related Receptor alpha antibody (ab126098)

    Applications: ChIP, IP, WB

  •  
  • Product image

    Anti-Estrogen Related Receptor alpha antibody [EPR46Y] - BSA and Azide free (ab239879)

    Applications: IP, WB

  •  
  • Product image

    Anti-Estrogen Related Receptor alpha antibody (ab150560)

    Applications: IHC-P

Clear all

Recently viewed products

  •  
  • Product image

    Anti-MVP antibody [EPR13227(B)] (ab175239)

  •  
  • Product image

    Anti-Survivin antibody [EP2880Y] (ab76424)

  •  
  • Product image

    Anti-HLA Class 1 ABC antibody [EPR22172] (ab225636)

  •  
  • Product image

    Anti-c-Myb antibody [EPR718(2)] (ab109127)

  •  
  • Product image

    Anti-PPP1CA + PPP1CB antibody [EP1511Y] (ab52619)

  •  
  • Product image

    Anti-SIRT2 antibody [EP1668Y] (ab51023)

Get resources and offers direct to your inbox Sign up
© 2021 Astana Biomed Group LLP. All rights reserved.