Anti-Estrogen Related Receptor alpha antibody (ab137489)
Key features and details
- Rabbit polyclonal to Estrogen Related Receptor alpha
- Suitable for: ChIP, IHC-P, IP, WB
- Reacts with: Mouse, Rat, Human
- Isotype: IgG
Overview
-
Product name
Anti-Estrogen Related Receptor alpha antibody
See all Estrogen Related Receptor alpha primary antibodies -
Description
Rabbit polyclonal to Estrogen Related Receptor alpha -
Host species
Rabbit -
Tested applications
Suitable for: ChIP, IHC-P, IP, WBmore details -
Species reactivity
Reacts with: Mouse, Rat, Human
Predicted to work with: Cow, Dog, Pig -
Immunogen
Synthetic peptide corresponding to Human Estrogen Related Receptor alpha aa 1-45 (N terminal).
Sequence:MSSQVVGIEPLYIKAEPASPDSPKGSSETETEPPVALAPGPAPTR
Database link: P11474 -
General notes
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.00
Preservative: 0.01% Thimerosal (merthiolate)
Constituents: 1.21% Tris, 0.75% Glycine, 10% Glycerol (glycerin, glycerine) -
Concentration information loading...
-
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Images
-
Anti-Estrogen Related Receptor alpha antibody (ab137489) at 1/500 dilution + Neuro2A whole cell extract at 30 µg
Predicted band size: 46 kDa10% SDS-PAGE
-
Anti-Estrogen Related Receptor alpha antibody (ab137489) at 1/500 dilution + Rat2 whole cell extract at 30 µg
Predicted band size: 46 kDa10% SDS-PAGE
-
Cross-linked ChIP was performed with MCF-7 chromatin extract and 5 μg of either control rabbit IgG or anti-ERR alpha antibody. The precipitated DNA was detected by PCR with primer set targeting to PS2 promoter or GAPDH promoter.
-
ERR alpha was immunoprecipitated from 40µ of HEK-293T whole cell lysate with ab137489 at 1/1000 dilution. Secondary antibody EasyBlot anti-rabbit IgG was used as secondary antibody.
Lane 1: 40 μg HEK-293T whole cell lysate.
Lane 2: Control with 2 μg of preimmune rabbit IgG.
Lane 3: Immunoprecipitation of ERR alpha protein by 2 μg of ERR alpha antibody.7.5% SDS-PAGE
-
Paraffin embedded mouse heart tissue stained for ERR alpha using ab137489 at 1/500 dilution in immunohistochemical analysis.
-
All lanes : Anti-Estrogen Related Receptor alpha antibody (ab137489) at 1/500 dilution
Lane 1 : 293T whole cell lysate
Lane 2 : A431 whole cell lysate
Lane 3 : H1299 whole cell lysate
Lysates/proteins at 30 µg per lane.
Predicted band size: 46 kDa
12% SDS PAGE