Anti-EPO-R antibody [VP2E8] (ab180791)
Key features and details
- Mouse monoclonal [VP2E8] to EPO-R
- Suitable for: Flow Cyt
- Reacts with: Human
- Isotype: IgG1
Overview
-
Product name
Anti-EPO-R antibody [VP2E8]
See all EPO-R primary antibodies -
Description
Mouse monoclonal [VP2E8] to EPO-R -
Host species
Mouse -
Tested applications
Suitable for: Flow Cytmore details -
Species reactivity
Reacts with: Human
Predicted to work with: Pig -
Immunogen
Other Immunogen Type corresponding to Human EPO-R (extracellular). Genetic immunisation with cDNA encoding the Extracellular domain of Human EPO-R.
Sequence:APPPNLPDPKFESKAALLAARGPEELLCFTERLEDLVCFWEEAASAGVGP GNYSFSYQLEDEPWKLCRLHQAPTARGAVRFWCSLPTADTSSFVPLELRV TAASGAPRYHRVIHINEVVLLDAPVGLVARLADESGHVVLRWLPPPETPM TSHIRYEVDVSAGNGAGSVQRVEILEGRTECVLSNLRGRTRYTFAVRARM AEPSFGGFWSAWSEPVSLLTPSDLDPLILTLSLILVVILVLLTVLALLSH RRALKQKIWPGIPSPESEFEGLFTTHKGNFQLWLYQNDGCLWWSPCTPFT EDPPASLEVLSERCWGTMQAVEPGTDDEGPLLEPVGSEHAQDTYLVLDKW LLPRNPPSEDLPGPGGSVDIVAMDEGSEASSCSSALASKPSPEGASAASF EYTILDPSSQLLRPWTLCPELPPTPPHLKYLYLVVSDSGISTDYSSGDSQ GAQGGLSDGPYSNPYENSLIPAAEPLPPSYVACS
Database link: P19235 -
Positive control
- BOSC23 cells transiently transfected with EPO-R.
-
General notes
Previously labelled as EPO Receptor.
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.20
Constituent: 100% PBS -
Concentration information loading...
-
Purity
Protein G purified -
Purification notes
ab180791 was purified by protein G affinity chromatography from cell culture supernatants and verified by CGE -
Clonality
Monoclonal -
Clone number
VP2E8 -
Isotype
IgG1 -
Research areas
Images
-
Flow cytometric staining of BOSC23 cells transiently transfected with an expression vector encoding either EPO-R (red curve) or an irrelevant protein black curve (control transfectant) labeling EPO-R with ab180791 at 1/200 dilution. A PE conjugated secondary antibody was used. A positive signal was obtained only with EPO-R transfected cells.
-
Capillary Gel Electrophoresis (CGE) analysis of purified ab180791 monoclonal antibody. Lane 1: molecular weight marker, Lane 2: 2 μg of purified ab180791. Internal control bands (240 kDa / 7 kDa / 4,5 kDa).