Anti-EKLF / KLF1 antibody [1B6A3] (ab175372)
Key features and details
- Mouse monoclonal [1B6A3] to EKLF / KLF1
- Suitable for: WB, Flow Cyt, IHC-P
- Reacts with: Human
- Isotype: IgG1
Overview
-
Product name
Anti-EKLF / KLF1 antibody [1B6A3]
See all EKLF / KLF1 primary antibodies -
Description
Mouse monoclonal [1B6A3] to EKLF / KLF1 -
Host species
Mouse -
Tested Applications & Species
See all applications and species dataApplication Species Flow Cyt HumanIHC-P HumanWB Human -
Immunogen
Recombinant fragment corresponding to Human EKLF/ KLF1 aa 208-362. Expressed in E. Coli.
Sequence:PAPQYQGHFQLFRGLQGPAPGPATSPSFLSCLGPGTVGTGLGGTAEDPGV IAETAPSKRGRRSWARKRQAAHTCAHPGCGKSYTKSSHLKAHLRTHTGEK PYACTWEGCGWRFARSDELTRHYRKHTGQRPFRCQLCPRAFSRSDHLALH MKRHL
Database link: Q13351 -
Positive control
- Human EKLF / KLF1 recombinant protein; HeLa cells; Human cervical and rectum cancer tissues
-
General notes
This product was changed from ascites to supernatant. Lot no’s high than GR252532-8 are from Tissue Culture Supernatant
The Life Science industry has been in the grips of a reproducibility crisis for a number of years. Abcam is leading the way in addressing the problem with our range of recombinant monoclonal antibodies and knockout edited cell lines for gold-standard validation.
One factor contributing to the crisis is the use of antibodies that are not suitable. This can lead to misleading results and the use of incorrect data informing project assumptions and direction. To help address this challenge, we have introduced an application and species grid on our primary antibody datasheets to make it easy to simplify identification of the right antibody for your needs.
Learn more here.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
Preservative: 0.05% Sodium azide
Constituent: 99% PBS -
Concentration information loading...
-
Purity
Protein G purified -
Purification notes
Purified from tissue culture supernatant. -
Clonality
Monoclonal -
Clone number
1B6A3 -
Isotype
IgG1 -
Research areas
Images
-
Anti-EKLF / KLF1 antibody [1B6A3] (ab175372) at 1/500 dilution + Human EKLF / KLF1 recombinant protein
Predicted band size: 38 kDaExpected MW is 42.6 kDa
-
Immunohistochemical analysis of paraffin-embedded Human rectum cancer tissue labeling EKLF / KLF1 using ab175372 at 1/200 dilution, followed by DAB staining.
-
Immunohistochemical analysis of paraffin-embedded Human cervical cancer tissue labeling EKLF / KLF1 using ab175372 at 1/200 dilution, followed by DAB staining.
-
Flow cytometric analysis of HeLa cells labeling EKLF / KLF1 using ab175372 at 1/200 dilution (green) and negative control (red).