Anti-EIF2B5 antibody (ab91563)
Key features and details
- Rabbit polyclonal to EIF2B5
- Suitable for: IHC-P, IP
- Reacts with: Human
- Isotype: IgG
Overview
-
Product name
Anti-EIF2B5 antibody
See all EIF2B5 primary antibodies -
Description
Rabbit polyclonal to EIF2B5 -
Host species
Rabbit -
Tested Applications & Species
See all applications and species dataApplication Species IHC-P HumanIP Human -
Immunogen
Synthetic peptide corresponding to Human EIF2B5 aa 550-600 (internal sequence).
Sequence:IKVFQNEVLGTLQRGKEENISCDNLVLEINSLKYAYNISLKEVMQVLSHV V
Database link: NP_003898.2 -
Positive control
- HeLa whole cell lysate
-
General notes
This product was previously labelled as eIF2B epsilon
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles. -
Storage buffer
pH: 7
Preservative: 0.09% Sodium azide
Constituent: Tris citrate/phosphate -
Concentration information loading...
-
Purity
Immunogen affinity purified -
Purification notes
Antibody was affinity purified using an epitope specific to eIF2B5 epsilon immobilized on solid support. -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Images
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-EIF2B5 antibody (ab91563)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) analysis of human breast carcinoma tissue labelling EIF2B5 with ab91563 at 1/1000 (1µg/ml). Detection: DAB.
-
ab91563 at 10 µg/mg lysate precipitating EIF2B5 in HeLa whole cell lysate following IP. Lane 1; IP with an antibody which recognizes an upstream epitope of EIF2B5. Lane 2; IP with ab91563. Lane 3; control IgG. In each case, 1 mg of lysate was used for IP and 20% of the IP was loaded. Detection by WB utilised the ECL with a 10 second exposure.