Anti-EDF1 antibody (ab174651)
Key features and details
- Rabbit polyclonal to EDF1
- Suitable for: IP, WB
- Reacts with: Human
- Isotype: IgG
Overview
-
Product name
Anti-EDF1 antibody -
Description
Rabbit polyclonal to EDF1 -
Host species
Rabbit -
Tested Applications & Species
See all applications and species dataApplication Species IP HumanWB Human -
Immunogen
Synthetic peptide within Human EDF1 aa 98-148. The exact sequence is proprietary. NP_003783.1.
Sequence:KINEKPQVIADYESGRAIPNNQVLGKIERAIGLKLRGKDIGKPIEKGPRA K
Database link: O60869 -
Positive control
- 293T, HeLa, and Jurkat whole cell lysates.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7
Preservative: 0.09% Sodium azide
Constituent: 99% Tris citrate/phosphate
pH 7 to 8 -
Concentration information loading... -
Purity
Immunogen affinity purified -
Purification notes
ab174651 was affinity purified using an epitope specific to EDF1 immobilized on solid support. -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Images
-
All lanes : Anti-EDF1 antibody (ab174651) at 0.100000001490116 µg/ml
Lane 1 : 293T whole cell lysate
Lane 2 : HeLa whole cell lysate
Lane 3 : Jurkat whole cell lysate
Lysates/proteins at 50 µg per lane.
Developed using the ECL technique.
Predicted band size: 16 kDa
Exposure time: 3 minutes
-
Detection of EDF1 in Immunoprecipitates of 293T whole cell lysates (1 mg for IP, 20% of IP loaded) using ab174651 at 6 µg/mg lysate for IP (Lane 1). For WB detection ab174651 was used at 1 µg/ml. Lane 2 represents control IgG IP.

