Call: +7 771 977 66 65, +7 705 421 2277
Sign in or Register
My basket

Astana Biomed Group, an authorized Abcam distributor in Central Asia

Abiomed homepage

  • Categories
    Signal Transduction
    Cancer
    Epigenetics and Nuclear Signaling
    Immunology
    Cell Biology
    Cardiovascular
    Neuroscience
    Tags & Cell Markers
    Kits/ Lysates/ Other
    Developmental Biology
    Microbiology
    Biochemicals
    Secondary antibodies
    Isotype/Loading Controls
    Antibody Arrays
  • About us
  • Partners
  • Contact
    Address

    Saryarka 32, 18, 010000, Astana city, Kazakhstan

    Telephone +7 771 977 66 65, +7 705 421 2277

    Email

    laboratory@ctlab.kz, orders@abiomed.kz

Back to category

Anti-BRIP1 antibody (ab126517)

Anti-BRIP1 antibody (ab126517)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)

Key features and details

  • Rabbit polyclonal to BRIP1
  • Suitable for: ICC/IF, WB, IHC-P
  • Reacts with: Human
  • Isotype: IgG

You may also be interested in

Product image
Mouse TIMP-1 Matched Antibody Pair Kit (ab221435)
Product image
Human FAS knockout HeLa cell lysate (ab256911)
Product image
Alexa Fluor® 488 Anti-MTCO1 antibody [1D6E1A8] (ab154477)
Pre-Coated 96 Well Microplate (12 x 8 well strips) SimpleStep ELISA® (ab206978)

Overview

  • Product name

    Anti-BRIP1 antibody
  • Description

    Rabbit polyclonal to BRIP1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IF, WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human BRIP1 aa 39-103.
    Sequence:

    PVAVEPGAAVRSLLSPGLLPHLLPALGFKNKTVLKKRCKDCYLVKRRGRW YVYCKTHPRHKQRQM

    Run BLAST with BLAST the sequence with ExPASy Run BLAST with BLAST the sequence with NCBI
  • Positive control

    • IHC-P: Human colon tissue; ICC: HeLa whole cells; WB: RT-4 and U-251 MG cell lysates.
  • General notes

     This product was previously labelled as MRPL36

     

    Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.

    Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.

    We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.

    In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.

    We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.

    Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.

    Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.
  • Storage buffer

    pH: 7.20
    Preservative: 0.02% Sodium azide
    Constituents: 40% Glycerol (glycerin, glycerine), 59% PBS
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

    • Tags & Cell Markers
    • Subcellular Markers
    • Organelles
    • Mitochondria
    • Epigenetics and Nuclear Signaling
    • DNA / RNA
    • Translation
    • Ribosome
    • Epigenetics and Nuclear Signaling
    • DNA / RNA
    • Translation
    • Mito. Translation

Images

  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-BRIP1 antibody (ab126517)
    Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-BRIP1 antibody (ab126517)

    Immunohistochemical analysis of human colon tissue labeling BRIP1 in the cytoplasm of glandular cells with ab126517 at a 1/50 dilution.

    Performed heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

  • Western blot - Anti-BRIP1 antibody (ab126517)
    Western blot - Anti-BRIP1 antibody (ab126517)
    All lanes : Anti-BRIP1 antibody (ab126517) at 0.4 µg/ml

    Lane 1 : RT4 (Human urinary bladder cancer cell line) whole cell lysate
    Lane 2 : U-251 MG (formally U-373 MG) (Human brain glioma cell line) whole cell lysate

    Predicted band size: 12 kDa

  • Immunocytochemistry/ Immunofluorescence - Anti-BRIP1 antibody (ab126517)
    Immunocytochemistry/ Immunofluorescence - Anti-BRIP1 antibody (ab126517)

    Immunohistochemical analysis of HeLa (Human epithelial cell line from cervix adenocarcinoma) whole cells labeling BRIP1 in the nuclear bodies and mitochondria with ab126517 at 2 µg/ml.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Clear all

Recently viewed products

  •  
  • Product image

    Anti-DYNC2LI1 antibody (ab230396)

  •  
  • Product image

    Anti-MTCO1 antibody (ab236105)

  •  
  • Product image

    Anti-CD38 antibody (ab125038)

  •  
  • Product image

    Anti-PCDH1 antibody (ab96232)

  •  
  • Product image

    Anti-Vitellogenin antibody (ab36877)

  •  
  • Product image

    Recombinant human CX3CL1 protein (Active) (ab269216)

Get resources and offers direct to your inbox Sign up
© 2021 Astana Biomed Group LLP. All rights reserved.