Anti-DIS3L2 antibody [6C7B2] (ab181743)
![Anti-DIS3L2 antibody [6C7B2] (ab181743)](https://www.abcam.com/ps/products/181/ab181743/Images/ab181743-210952-anti-dis3l2-antibody-6c7b2-western-blot.jpg "Anti-DIS3L2 antibody [6C7B2] (ab181743)")
Key features and details
- Mouse monoclonal [6C7B2] to DIS3L2
- Suitable for: Flow Cyt, IHC-P, WB
- Reacts with: Human, Recombinant fragment
- Isotype: IgG1
Overview
-
Product name
Anti-DIS3L2 antibody [6C7B2] -
Description
Mouse monoclonal [6C7B2] to DIS3L2 -
Host species
Mouse -
Tested applications
Suitable for: Flow Cyt, IHC-P, WBmore details -
Species reactivity
Reacts with: Human, Recombinant fragment -
Immunogen
Recombinant fragment corresponding to Human DIS3L2 aa 27-250. Expressed in E. Coli.
Sequence:DIGASPGDKKSKNRSTRGKKKSIFETYMSKEDVSEGLKRGTLIQGVLRIN PKKFHEAFIPSPDGDRDIFIDGVVARNRALNGDLVVVKLLPEEHWKVVKP ESNDKETEAAYESDIPEELCGHHLPQQSLKSYNDSPDVIVEAQFDGSDSE DGHGITQNVLVDGVKKLSVCVSEKGREDGDAPVTKDETTCISQDTRALSE KSLQRSAKVVYILEKKHSRAATGF
Database link: Q8IYB7 -
Positive control
- HeLa and HepG2 cell lysates; DIS3L2 recombinant protein; DIS3L2 (aa 27-250)-hIgGFc transfected HEK293 cell lysate; Jurkat cells; Human endometrial cancer and Human bladder cancer tissues.
-
General notes
The Life Science industry has been in the grips of a reproducibility crisis for a number of years. Abcam is leading the way in addressing this with our range of recombinant monoclonal antibodies and knockout edited cell lines for gold-standard validation. Please check that this product meets your needs before purchasing.
If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, along with publications, customer reviews and Q&As
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
Preservative: 0.05% Sodium azide
Constituent: 99% PBS
0.5% protein stabilizer -
Concentration information loading... -
Purity
Protein G purified -
Purification notes
Purified from tissue culture supernatant. -
Clonality
Monoclonal -
Clone number
6C7B2 -
Isotype
IgG1 -
Research areas
Images
-
Western blot - Anti-DIS3L2 antibody [6C7B2] (ab181743)All lanes : Anti-DIS3L2 antibody [6C7B2] (ab181743) at 1/500 dilution
Lane 1 : HeLa cell lysate
Lane 2 : HepG2 cell lysate
Predicted band size: 99 kDa
-
![Western blot - Anti-DIS3L2 antibody [6C7B2] (ab181743)](https://www.abcam.com/ps/products/181/ab181743/Images/ab181743-210954-anti-dis3l2-antibody-6c7b2-western-blot.jpg)
Western blot - Anti-DIS3L2 antibody [6C7B2] (ab181743)All lanes : Anti-DIS3L2 antibody [6C7B2] (ab181743) at 1/500 dilution
Lane 1 : non-transfected HEK293 cell lysate
Lane 2 : DIS3L2 (aa 27-250)-hIgGFc transfected HEK293 cell lysate
Predicted band size: 99 kDa
-
![Western blot - Anti-DIS3L2 antibody [6C7B2] (ab181743)](https://www.abcam.com/ps/products/181/ab181743/Images/ab181743-210953-anti-dis3l2-antibody-6c7b2-western-blot.jpg)
Western blot - Anti-DIS3L2 antibody [6C7B2] (ab181743)Anti-DIS3L2 antibody [6C7B2] (ab181743) at 1/500 dilution + DIS3L2 recombinant protein
Predicted band size: 99 kDa
-
![Flow Cytometry - Anti-DIS3L2 antibody [6C7B2] (ab181743)](https://www.abcam.com/ps/products/181/ab181743/Images/ab181743-210958-anti-dis3l2-antibody-6c7b2-flow-cytometry.jpg)
Flow Cytometry - Anti-DIS3L2 antibody [6C7B2] (ab181743)Flow Cytometrical analysis of Jurkat cells labeling DIS3L2 with ab181743 at 1/200 (green) compared to a negative control antibody (red).
-
![Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-DIS3L2 antibody [6C7B2] (ab181743)](https://www.abcam.com/ps/products/181/ab181743/Images/ab181743-210957-ab181743IHCb.jpg)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-DIS3L2 antibody [6C7B2] (ab181743)Immunohistochemical analysis of paraffin embedded Human bladder cancer tissue labeling DIS3L2 with ab181743 at 1/200.
-
![Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-DIS3L2 antibody [6C7B2] (ab181743)](https://www.abcam.com/ps/products/181/ab181743/Images/ab181743-210956-anti-dis3l2-antibody-6c7b2-immunohistochemistry.jpg)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-DIS3L2 antibody [6C7B2] (ab181743)Immunohistochemical analysis of paraffin embedded Human endometrial cancer tissue labeling DIS3L2 with ab181743 at 1/200.