Anti-CHX10 antibody (ab16141)
Key features and details
- Sheep polyclonal to CHX10
- Suitable for: WB
- Reacts with: Mouse, Rat
- Isotype: IgG
Overview
-
Product name
Anti-CHX10 antibody
See all CHX10 primary antibodies -
Description
Sheep polyclonal to CHX10 -
Host species
Sheep -
Tested Applications & Species
See all applications and species dataApplication Species WB MouseRat -
Immunogen
Recombinant fragment corresponding to Human CHX10 aa 264-361 (C terminal).
Sequence:EAAAEKPEGERQALPKLDKMEQDERGPDAQAAISQEELRENSIAVLRAKA QEHSTKVLGTVSGPDSLARSTEKPEEEEAMDEDRPAERLSPPQLEDMA
Database link: P58304 -
General notes
Chx10 is a 46kDa homeodomain protein of the paired-like class that is essential for development of the mammalian eye. Mutations in Chx10 cause microphthalmia, a cause of congenital blindness in humans, and the ocular retardation (or) phenotype in mice. In the developing mouse retina Chx10 is expressed in retinal progenitors, while in the mature retina, Chx10 expression becomes restricted to bipolar neurons. Concurrent with these expression patterns, the Chx10-/- (or) retina is thin due to a defect in proliferation of retinal progenitors, and lacks bipolar neurons. Chx10 is also expressed in the developing brainstem, thalamus, and spinal cord.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C. Avoid freeze / thaw cycle. -
Storage buffer
Preservative: 0.08% Sodium azide
Constituent: PBS -
Concentration information loading... -
Purity
Ammonium Sulphate Precipitation -
Clonality
Polyclonal -
Isotype
IgG -
Research areas

