Recombinant Picornain 3C protein (ab157275)
Key features and details
- Expression system: Escherichia coli
- Endotoxin level:
- Active: Yes
- Suitable for: Functional Studies, SDS-PAGE
-
Product name
Recombinant Picornain 3C protein -
Biological activity
Substrate recognition and cleavage are likely to be dependent not only upon primary structural signals, but also upon the secondary and tertiary structures of the fusion protein as It has been demonstrated that the enzyme exhibits highest activity around neutral pH at temperature ranging from 22 to 37?, even retaining robust activity at 4?. Thus, cleavage can be performed at low temperature to enhance the stability of the target protein.SpecificityThe enzyme recognizes the cleavage site: Leu-Glu-Val-Leu-Phe-Gln-↓-Gly-Pro.
-
Endotoxin level
Expression system
Escherichia coliAccession
Protein length
Full length proteinAnimal free
NoNature
Recombinant-
Sequence
GPNTEFALSLLRKNIMTITTSKGEFTGLGIHDRVCVIPTHAQPGDDVLVN GQKIRVKDKYKLVDPENINLELTVLTLDRNEKFRDIRGFISEDLEGVDAT LVVHSNNFTNTILEVGPVTMAGLINLSSTPTNRMIRYDYATKTGQCGGVL CATGKIFGIHVGGNGRQGFSAQLKKQYFVEKQ -
Predicted molecular weight
22 kDa -
Amino acids
1 to 182
Specifications
Our Abpromise guarantee covers the use of ab157275 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
Functional Studies
SDS-PAGE
-
Form
Lyophilized -
Additional notes
Substrate recognition and cleavage are likely to be dependent not only upon primary structural signals, but also upon the secondary and tertiary structures of the fusion protein as It has been demonstrated that the enzyme exhibits highest activity around neutral pH at temperature ranging from 22 to 37°C, even retaining robust activity at 4°C. Thus, cleavage can be performed at low temperature to enhance the stability of the target protein. The catalytic activity is insensitive to organic solvents (up to 10%); however, it can be strongly stimulated by high concentration of anions such as sulfate.
The high specificity of ab157275 makes it an ideal tool for cleaving fusion proteins at definite cleavage sites. The enzyme recognizes the cleavage site: Leu-Glu-Val-Leu-Phe-Gln-Gly-Pro. >1 Units/µg. One unit will cleave >95% of 100 µg control fusion protein in 50 mM Tris-HCl, 150 mM NaCl, pH 7.5 at 4°C for 16 h. -
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.
pH: 7.4
Constituents: 0.61% Tris, 0.05% Tween, 0.03% EDTA, 0.88% Sodium chlorideThis product is an active protein and may elicit a biological response in vivo, handle with caution.
-
ReconstitutionReconstitute with 50% glycerol to a concentration of 1 mg/ml.
General Info
-
Alternative names
- 3C
- P3C
- Protease 3C
Images
-
Functional Studies - Recombinant Picornain 3C protein (ab157275)A 52 kDa Fc-Fusion protein (C) at 1/mg/ml is incubated with ab157275 at the ratio of (1) 1:50 (2) 1:100 (3) 1:200 (4) 1:400 (5) 1:800 (6) 1:1000 (w/w) in a buffer of 50 mM TRIS-HCl, 150mM NaCl, 1mM EDTA, 1mM dithiothreitol, pH 7.0 at 4 degC for 16 hours.
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
References (0)
ab157275 has not yet been referenced specifically in any publications.
Preparation and Storage
- 3C
- P3C
- Protease 3C
Images
-
Functional Studies - Recombinant Picornain 3C protein (ab157275)A 52 kDa Fc-Fusion protein (C) at 1/mg/ml is incubated with ab157275 at the ratio of (1) 1:50 (2) 1:100 (3) 1:200 (4) 1:400 (5) 1:800 (6) 1:1000 (w/w) in a buffer of 50 mM TRIS-HCl, 150mM NaCl, 1mM EDTA, 1mM dithiothreitol, pH 7.0 at 4 degC for 16 hours.