Call: +7 771 977 66 65, +7 705 421 2277
Sign in or Register
My basket

Astana Biomed Group, an authorized Abcam distributor in Central Asia

Abiomed homepage

  • Categories
    Signal Transduction
    Cancer
    Epigenetics and Nuclear Signaling
    Immunology
    Cell Biology
    Cardiovascular
    Neuroscience
    Tags & Cell Markers
    Kits/ Lysates/ Other
    Developmental Biology
    Microbiology
    Biochemicals
    Secondary antibodies
    Isotype/Loading Controls
    Antibody Arrays
  • About us
  • Partners
  • Contact
    Address

    Saryarka 32, 18, 010000, Astana city, Kazakhstan

    Telephone +7 771 977 66 65, +7 705 421 2277

    Email

    laboratory@ctlab.kz, orders@abiomed.kz

Back to category
Developmental Biology Lineage specification Endoderm

Anti-CDX2 antibody [3G9B9] (ab181488)

Anti-CDX2 antibody [3G9B9] (ab181488)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)

Key features and details

  • Mouse monoclonal [3G9B9] to CDX2
  • Suitable for: WB, Flow Cyt
  • Reacts with: Human, Recombinant fragment
  • Isotype: IgG1

You may also be interested in

Product image
Alexa Fluor® 488 Anti-CDX2 antibody [EPR2764Y] (ab195007)
Product image
Anti-CDX2 antibody [EPR2764Y] - BSA and Azide free (ab220799)
Product image
Anti-CDX2 antibody - N-terminal (ab220070)
Product image
Anti-CDX2 antibody (ab48009)

Overview

  • Product name

    Anti-CDX2 antibody [3G9B9]
    See all CDX2 primary antibodies
  • Description

    Mouse monoclonal [3G9B9] to CDX2
  • Host species

    Mouse
  • Tested applications

    Suitable for: WB, Flow Cytmore details
  • Species reactivity

    Reacts with: Human, Recombinant fragment
  • Immunogen

    Recombinant fragment corresponding to Human CDX2 aa 176-303. (Expressed in E.coli).
    Sequence:

    SLGSQVKTRTKDKYRVVYTDHQRLELEKEFHYSRYITIRRKAELAATLGL SERQVKIWFQNRRAKERKINKKKLQQQQQQQPPQPPPPPPQPPQPQPGPL RSVPEPLSPVSSLQASVPGS VPGVLGPT


    Database link: Q99626
    Run BLAST with BLAST the sequence with ExPASy Run BLAST with BLAST the sequence with NCBI
  • Positive control

    • Human CDX2 (AA: 176-303) recombinant protein; CDX2 (AA: 176-303)-hIgGFc transfected HEK293 cell lysate; HeLa cells.
  • General notes

    Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.

    Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.

    We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.

    In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.

    We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.

    Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.

    Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    Preservative: 0.05% Sodium azide
    Constituent: 99% PBS

    Contains 0.5% protein stabilizer.
  • Concentration information loading...
  • Purity

    Protein G purified
  • Purification notes

    Purified from tissue culture supernatant.
  • Clonality

    Monoclonal
  • Clone number

    3G9B9
  • Isotype

    IgG1
  • Research areas

    • Stem Cells
    • Lineage Markers
    • Endoderm
    • Epigenetics and Nuclear Signaling
    • Transcription
    • Transcription Factors
    • Developmental Biology
    • Lineage specification
    • Endoderm
    • Developmental Biology
    • Lineage specification
    • Trophectoderm

Images

  • Flow Cytometry - Anti-CDX2 antibody [3G9B9] (ab181488)
    Flow Cytometry - Anti-CDX2 antibody [3G9B9] (ab181488)

    Flow cytometric analysis of Hela cells labeling CDX2 with ab181488 at 1/200 dilution (green) compared to a negative control (red).

  • Western blot - Anti-CDX2 antibody [3G9B9] (ab181488)
    Western blot - Anti-CDX2 antibody [3G9B9] (ab181488)
    All lanes : Anti-CDX2 antibody [3G9B9] (ab181488) at 1/500 dilution

    Lane 1 : HEK293 cell lysate
    Lane 2 : CDX2 (AA: 176-303)-hIgGFc transfected HEK293 cell lysate

    Predicted band size: 33 kDa

  • Western blot - Anti-CDX2 antibody [3G9B9] (ab181488)
    Western blot - Anti-CDX2 antibody [3G9B9] (ab181488)
    Anti-CDX2 antibody [3G9B9] (ab181488) at 1/500 dilution + CDX2 (AA: 176-303) recombinant protein.

    Predicted band size: 33 kDa



    Expected MWt is 40.1 kDa.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Alternative products to Anti-CDX2 antibody [3G9B9] (ab181488)

  •  
  • Product image

    Anti-CDX2 antibody [SP54] - BSA and Azide free (ab240936)

    Applications: Flow Cyt, ICC/IF, IHC-P

  •  
  • Product image

    Alexa Fluor® 647 Anti-CDX2 antibody [EPR2764Y] (ab195008)

    Applications: Flow Cyt, ICC/IF

  •  
  • Product image

    Anti-CDX2 antibody [EPR2764Y] (ab76541)

    Applications: Flow Cyt, ICC/IF, IHC-P, WB

  •  
  • Product image

    Alexa Fluor® 488 Anti-CDX2 antibody [EPR2764Y] (ab195007)

    Applications: Flow Cyt, ICC/IF

  •  
  • Product image

    Anti-CDX2 antibody [EPR2764Y] - BSA and Azide free (ab220799)

    Applications: Flow Cyt, ICC/IF, IHC-P, WB

  •  
  • Product image

    Anti-CDX2 antibody [SP54] (ab101532)

    Applications: Flow Cyt, ICC/IF, IHC-P

Clear all

Recently viewed products

  •  
  • Product image

    Anti-CD34 antibody [EP373Y] (ab81289)

  •  
  • Product image

    Anti-ASK1 antibody [EP553Y] (ab45178)

  •  
  • Product image

    Anti-PTEN antibody [Y184] (ab32199)

  •  
  • Product image

    Anti-Lck antibody [Y123] (ab32149)

  •  
  • ION Potassium Green-2 AM, K<sup>+</sup> indicator (ab142806)

  •  
  • Product image

    m6A RNA Methylation Assay Kit (Fluorometric) (ab233491)

Get resources and offers direct to your inbox Sign up
© 2021 Astana Biomed Group LLP. All rights reserved.