Anti-CDR2L antibody (ab121705)
Key features and details
- Rabbit polyclonal to CDR2L
- Suitable for: ICC/IF, WB, IHC-P
- Reacts with: Mouse, Rat, Human
- Isotype: IgG
Overview
-
Product name
Anti-CDR2L antibody -
Description
Rabbit polyclonal to CDR2L -
Host species
Rabbit -
Tested applications
Suitable for: ICC/IF, WB, IHC-Pmore details -
Species reactivity
Reacts with: Mouse, Rat, Human -
Immunogen
Recombinant fragment corresponding to Human CDR2L aa 395-464.
Sequence:DSSWRDLRGGEEGQGEVKAGEKSLSQHVEAVDKRLEQSQPEYKALFKEIF SRIQKTKADINATKVKTHSS
-
Positive control
- IHC-P: Human duodenum, cerebellum and pancreas tissue; WB: RT-4, U-251 MG and Tonsil tissue lysate; ICC/IF: U-2OS cells.
-
General notes
This product was previously labelled as CDRL2
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles. -
Storage buffer
pH: 7.20
Preservative: 0.02% Sodium azide
Constituents: 59% PBS, 40% Glycerol (glycerin, glycerine) -
Concentration information loading... -
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Images
-
Western blot - Anti-CDR2L antibody (ab121705)Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells)
Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells) -
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-CDR2L antibody (ab121705)Immunohistochemical analysis of paraffin-embedded human duodenum tissue labelling CDR2L with ab121705 at 1/50 dilution.
-
Immunocytochemistry/ Immunofluorescence - Anti-CDR2L antibody (ab121705)Immunofluorescent staining of Human cell line U-2 OS shows positivity in cytoplasm. Recommended concentration of ab121705 1-4 µg/ml. Cells treated with PFA/Triton X-100. -
Western blot - Anti-CDR2L antibody (ab121705)All lanes : Anti-CDR2L antibody (ab121705) at 1/250 dilution
Lane 1 : RT-4 cell lysate.
Lane 2 : U-251 MG cell lysate.
Lane 3 : Human Plasma
Lane 4 : Human Liver tissue lysate.
Lane 5 : Human Tonsil tissue lysate.
Developed using the ECL technique.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-CDR2L antibody (ab121705)Immunohistochemical analysis of paraffin-embedded human cerebellum tissue labelling CDR2L with ab121705 at 1/50 dilution.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-CDR2L antibody (ab121705)Immunohistochemical analysis of paraffin-embedded human skeletal muscle tissue labelling CDR2L with ab121705 at 1/50 dilution.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-CDR2L antibody (ab121705)Immunohistochemical analysis of paraffin-embedded human pancreas tissue labelling CDR2L with ab121705 at 1/50 dilution.