Anti-CCM2 antibody [OTI2E4] (ab123930)
Key features and details
- Mouse monoclonal [OTI2E4] to CCM2
- Suitable for: WB, IHC-P, ICC/IF
- Reacts with: Human, African green monkey
- Isotype: IgG1
Overview
-
Product name
Anti-CCM2 antibody [OTI2E4]
See all CCM2 primary antibodies -
Description
Mouse monoclonal [OTI2E4] to CCM2 -
Host species
Mouse -
Tested applications
Suitable for: WB, IHC-P, ICC/IFmore details -
Species reactivity
Reacts with: Human, African green monkey -
Immunogen
Recombinant full length protein corresponding to Human CCM2 aa 1-444. Produced in HEK-293T cells (NP_113631).
Sequence:MEEEGKKGKKPGIVSPFKRVFLKGEKSRDKKAHEKVTERRPLHTVVLSLP ERVEPDRLLSDYIEKEVKYLGQLTSIPGYLNPSSRTEILHFIDNAKRAHQ LPGHLTQEHDAVLSLSAYNVKLAWRDGEDIILRVPIHDIAAVSYVRDDAA HLVVLKTAQDPGISPSQSLCAESSRGLSAGSLSESAVGPVEACCLVILAA ESKVAAEELCCLLGQVFQVVYTESTIDFLDRAIFDGASTPTHHLSLHSDD SSTKVDIKETYEVEASTFCFPESVDVGGASPHSKTISESELSASATELLQ DYMLTLRTKLSSQEIQQFAALLHEYRNGASIHEFCINLRQLYGDSRKFLL LGLRPFIPEKDSQHFENFLETIGVKDGRGIITDSFGRHRRALSTTSSSTT NGNRATGSSDDRSAPSEGDEWDRMISDISSDIEALGCSMDQDSA
Database link: Q9BSQ5 -
Positive control
- WB: HEK-293T cells transfected with pCMV6-ENTRY CCM2 cDNA. IHC-P: Human kidney tissue. ICC/IF: COS-7 cells transiently transfected by pCMV6-ENTRY CCM2 cDNA.
-
General notes
Clone OTI2E4 (formerly 2E4).
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.30
Preservative: 0.02% Sodium azide
Constituents: PBS, 50% Glycerol, 1% BSA -
Concentration information loading...
-
Purity
Affinity purified -
Purification notes
Purified from cell culture supernatant by affinity chromatography. -
Clonality
Monoclonal -
Clone number
OTI2E4 -
Isotype
IgG1 -
Research areas
Images
-
All lanes : Anti-CCM2 antibody [OTI2E4] (ab123930) at 1/2000 dilution
Lane 1 : HEK-293T (Human epithelial cell line from embryonic kidney transformed with large T antigen) cells transfected with pCMV6-ENTRY control cDNA
Lane 2 : HEK-293T cells transfected with pCMV6-ENTRY CCM2 cDNA
Lysates/proteins at 5 µg per lane.
Predicted band size: 49 kDa
-
pCMV6-ENTRY CCM2 cDNA transfected COS-7 (African green monkey kidney fibroblast-like cell line) cells stained for CCM2 using ab123930 at a 1/100 dilution in ICC/IF.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-CCM2 antibody [OTI2E4] (ab123930)
Paraffin-embedded human kidney tissue stained for CCM2 with ab123930 at a 1/150 dilution in immunohistochemical analysis. Heat-induced epitope retrieval by 10 mM citric buffer, pH 6.0, 100°C for 10 minutes.