Anti-BOZ-F1 antibody (ab176683)
Key features and details
- Rabbit polyclonal to BOZ-F1
- Suitable for: IP, WB
- Reacts with: Human
- Isotype: IgG
Overview
-
Product name
Anti-BOZ-F1 antibody -
Description
Rabbit polyclonal to BOZ-F1 -
Host species
Rabbit -
Tested Applications & Species
See all applications and species dataApplication Species IP HumanWB Human -
Immunogen
Synthetic peptide within Human BOZ-F1 aa 350-400. The exact sequence is proprietary.
Sequence:LTGQVVQEGTRRYRLCNECLAEFGIDSLPIDLEAEQHLMSPSDGDKDSRW H
Database link: Q96BR9 -
Positive control
- HeLa, Jurkat or 293T lysate.
-
General notes
Previously labelled as ZBTB8A.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 6.8
Preservative: 0.09% Sodium azide
Constituents: 0.1% BSA, 99% Tris buffered saline -
Concentration information loading... -
Purity
Immunogen affinity purified -
Purification notes
ab176683 was affinity purified using an epitope specific to BOZ-F1 immobilized on solid support. -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Images
-
Detection of Human BOZ-F1 by Western Blot of Immunoprecipitates.
ab176683 at 1 µg/ml, staining BOZ-F1 in HeLa whole cell lysate immunoprecipitated using ab176683 at 6 µg/mg lysate (1 mg/IP; 20% of IP loaded/lane). Detection: Chemiluminescence with an exposure time of 30 seconds.
-
All lanes : Anti-BOZ-F1 antibody (ab176683) at 0.04 µg/ml
Lane 1 : HeLa lysate at 50 µg
Lane 2 : HeLa lysate at 15 µg
Lane 3 : Jurkat lysate at 50 µg
Lane 4 : 293T lysate at 50 µg
Predicted band size: 50 kDa
Exposure time: 3 minutes

