Anti-BMP8a/OP-2 antibody (ab154373)
Key features and details
- Rabbit polyclonal to BMP8a/OP-2
- Suitable for: WB, ICC/IF
- Reacts with: Mouse, Human
- Isotype: IgG
Overview
-
Product name
Anti-BMP8a/OP-2 antibody
See all BMP8a/OP-2 primary antibodies -
Description
Rabbit polyclonal to BMP8a/OP-2 -
Host species
Rabbit -
Tested applications
Suitable for: WB, ICC/IFmore details -
Species reactivity
Reacts with: Mouse, Human
Predicted to work with: Rat -
Immunogen
Synthetic peptide corresponding to Human BMP8a/OP-2 aa 336-402 (C terminal).
Sequence:FPLDSCMNATNHAILQSLVHLMKPNAVPKACCAPTKLSATSVLYYDSSNN VILRKHRNMVVKACGCH
Database link: Q7Z5Y6 -
Positive control
- 293T, A431, H1299, HeLaS3 or Raji whole cell lysate; mouse ESC D3.
-
General notes
This product was previously labelled as BMP8a
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.00
Preservative: 0.01% Thimerosal (merthiolate)
Constituents: 1.21% Tris, 0.75% Glycine, 10% Glycerol (glycerin, glycerine) -
Concentration information loading...
-
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Images
-
All lanes : Anti-BMP8a/OP-2 antibody (ab154373) at 1/500 dilution
Lane 1 : H1299 whole cell lysate
Lane 2 : Raji whole cell lysate
Lysates/proteins at 30 µg per lane.
Predicted band size: 45 kDa
7.5% SDS PAGE -
Immunofluorescence analysis of paraformaldehyde-fixed mouse ESC D3, labeling BMP8a/OP-2 using ab154373 at 1/200 dilution. Lower panel co-stained with Hoechst 33342.