Call: +7 771 977 66 65, +7 705 421 2277
Sign in or Register
My basket

Astana Biomed Group, an authorized Abcam distributor in Central Asia

Abiomed homepage

  • Categories
    Signal Transduction
    Cancer
    Epigenetics and Nuclear Signaling
    Immunology
    Cell Biology
    Cardiovascular
    Neuroscience
    Tags & Cell Markers
    Kits/ Lysates/ Other
    Developmental Biology
    Microbiology
    Biochemicals
    Secondary antibodies
    Isotype/Loading Controls
    Antibody Arrays
  • About us
  • Partners
  • Contact
    Address

    Saryarka 32, 18, 010000, Astana city, Kazakhstan

    Telephone +7 771 977 66 65, +7 705 421 2277

    Email

    laboratory@ctlab.kz, orders@abiomed.kz

Back to category
Signal Transduction Metabolism Plasma Membrane ATPases

Anti-ATP6V0D1/P39 antibody (ab56441)

Price and availability

381 945 ₸

Availability

Order now and get it on Wednesday March 10, 2021

Anti-ATP6V0D1/P39 antibody (ab56441)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)

Key features and details

  • Mouse monoclonal to ATP6V0D1/P39
  • Suitable for: WB, IHC-P, ICC/IF, Flow Cyt
  • Reacts with: Human
  • Isotype: IgG1

You may also be interested in

Product image
Human ABCF3 knockout HeLa cell lysate (ab258774)
Product image
Anti-FXYD3 antibody [EPR17160] - BSA and Azide free (ab251433)
Product image
Anti-MRP5 antibody [6C6] (ab230674)
Product image
Anti-alpha 1 Sodium Potassium ATPase (phospho S16) antibody (ab194532)

Overview

  • Product name

    Anti-ATP6V0D1/P39 antibody
    See all ATP6V0D1/P39 primary antibodies
  • Description

    Mouse monoclonal to ATP6V0D1/P39
  • Host species

    Mouse
  • Tested Applications & Species

    Application Species
    Flow Cyt
    Human
    ICC/IF
    Human
    IHC-P
    Human
    WB
    Human
    See all applications and species data
  • Immunogen

    Recombinant fragment corresponding to Human ATP6V0D1/P39 aa 238-309.
    Sequence:

    AKLFPHCGRLYPEGLAQLARADDYEQVKNVADYYPEYKLLFEGAGSNPGD KTLEDRFFEHEVKLNKLAFLN

    Run BLAST with BLAST the sequence with ExPASy Run BLAST with BLAST the sequence with NCBI
  • General notes

    This product was changed from ascites to tissue culture supernatant on 13th Feb 2019. Please note that the dilutions may need to be adjusted accordingly. If you have any questions, please do not hesitate to contact our scientific support team.

     This product was previously labelled as ATP6V0D1

     

    The Life Science industry has been in the grips of a reproducibility crisis for a number of years. Abcam is leading the way in addressing the problem with our range of recombinant monoclonal antibodies and knockout edited cell lines for gold-standard validation.

    One factor contributing to the crisis is the use of antibodies that are not suitable. This can lead to misleading results and the use of incorrect data informing project assumptions and direction. To help address this challenge, we have introduced an application and species grid on our primary antibody datasheets to make it easy to simplify identification of the right antibody for your needs.

    Learn more here.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
  • Storage buffer

    pH: 7.4
  • Concentration information loading...
  • Purity

    Tissue culture supernatant
  • Clonality

    Monoclonal
  • Isotype

    IgG1
  • Light chain type

    kappa
  • Research areas

    • Signal Transduction
    • Metabolism
    • Plasma Membrane
    • ATPases
    • Metabolism
    • Types of disease
    • Cancer

Images

  • Western blot - Anti-ATP6V0D1/P39 antibody (ab56441)
    Western blot - Anti-ATP6V0D1/P39 antibody (ab56441)

    ATP6V0D1/P39 antibody (ab56441) at 1ug/lane + HeLa cell lysate at 25ug/lane.

    This image was generated using the ascites version of the product.

  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-ATP6V0D1/P39 antibody (ab56441)
    Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-ATP6V0D1/P39 antibody (ab56441)

    ATP6V0D1/P39 antibody (ab56441) used in immunohistochemistry at 5ug/ml on formalin fixed and paraffin embedded human stomach.

    This image was generated using the ascites version of the product.

  • Immunocytochemistry/ Immunofluorescence - Anti-ATP6V0D1/P39 antibody (ab56441)
    Immunocytochemistry/ Immunofluorescence - Anti-ATP6V0D1/P39 antibody (ab56441)

    ICC/IF image of ab56441 stained HeLa cells. The cells were 4% formaldehyde fixed (10 min) and then incubated in 1%BSA / 10% normal goat serum / 0.3M glycine in 0.1% PBS-Tween for 1h to permeabilise the cells and block non-specific protein-protein interactions. The cells were then incubated with the antibody (ab56441, 10µg/ml) overnight at +4°C. The secondary antibody (green) was Alexa Fluor® 488 goat anti-mouse IgG (H+L) used at a 1/1000 dilution for 1h. Alexa Fluor® 594 WGA was used to label plasma membranes (red) at a 1/200 dilution for 1h. DAPI was used to stain the cell nuclei (blue) at a concentration of 1.43µM.

    This image was generated using the ascites version of the product.

  • Flow Cytometry - Anti-ATP6V0D1/P39 antibody (ab56441)
    Flow Cytometry - Anti-ATP6V0D1/P39 antibody (ab56441)

    Overlay histogram showing HeLa cells stained with ab56441 (red line). The cells were fixed with 80% methanol (5 min) and then permeabilized with 0.1% PBS-Tween for 20 min. The cells were then incubated in 1x PBS / 10% normal goat serum / 0.3M glycine to block non-specific protein-protein interactions followed by the antibody (ab56441, 1μg/1x106 cells) for 30 min at 22°C. The secondary antibody used was DyLight® 488 goat anti-mouse IgG (H+L) (ab96879) at 1/500 dilution for 30 min at 22°C. Isotype control antibody (black line) was a mix of mouse IgG1 [ICIGG1], (ab91353, 2μg/1x106 cells) used under the same conditions. Acquisition of >5,000 events was performed. This antibody gave a positive signal in HeLa cells fixed with 4%PFA/permeabilized in 0.1% PBS-Tween used under the same conditions.

    This image was generated using the ascites version of the product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Alternative products to Anti-ATP6V0D1/P39 antibody (ab56441)

  •  
  • Product image

    Anti-ATP6V0D1/P39 antibody [EPR18320] (ab202897)

    Applications: Flow Cyt, ICC/IF, IHC-P, IP, WB

  •  
  • Product image

    Anti-ATP6V0D1/P39 antibody [EPR18320-38] (ab202899)

    Applications: Flow Cyt, ICC/IF, IHC-P, IP, WB

  •  
  • Product image

    Anti-ATP6V0D1/P39 antibody (ab155594)

    Applications: WB

Clear all

Recently viewed products

  •  
  • Product image

    Anti-KLLN antibody [EPR16934] (ab197892)

  •  
  • Product image

    Anti-DDAH2 antibody [EPR15508(B)] (ab184166)

  •  
  • Product image

    Anti-AP2B1 antibody [EPR7567] (ab129168)

  •  
  • Product image

    Anti-Fibroblast activation protein, alpha antibody (ab53066)

  •  
  • Product image

    Anti-Myelin PLP antibody [plpc 1] (ab9311)

  •  
  • Product image

    Anti-KCTD6 antibody - C-terminal (ab204317)

Get resources and offers direct to your inbox Sign up
© 2021 Astana Biomed Group LLP. All rights reserved.