Anti-ATP6V0D1/P39 antibody (ab56441)
Key features and details
- Mouse monoclonal to ATP6V0D1/P39
- Suitable for: WB, IHC-P, ICC/IF, Flow Cyt
- Reacts with: Human
- Isotype: IgG1
Overview
-
Product name
Anti-ATP6V0D1/P39 antibody
See all ATP6V0D1/P39 primary antibodies -
Description
Mouse monoclonal to ATP6V0D1/P39 -
Host species
Mouse -
Tested Applications & Species
See all applications and species dataApplication Species Flow Cyt HumanICC/IF HumanIHC-P HumanWB Human
-
Immunogen
Recombinant fragment corresponding to Human ATP6V0D1/P39 aa 238-309.
Sequence:AKLFPHCGRLYPEGLAQLARADDYEQVKNVADYYPEYKLLFEGAGSNPGD KTLEDRFFEHEVKLNKLAFLN
-
General notes
This product was changed from ascites to tissue culture supernatant on 13th Feb 2019. Please note that the dilutions may need to be adjusted accordingly. If you have any questions, please do not hesitate to contact our scientific support team.
This product was previously labelled as ATP6V0D1
The Life Science industry has been in the grips of a reproducibility crisis for a number of years. Abcam is leading the way in addressing the problem with our range of recombinant monoclonal antibodies and knockout edited cell lines for gold-standard validation.
One factor contributing to the crisis is the use of antibodies that are not suitable. This can lead to misleading results and the use of incorrect data informing project assumptions and direction. To help address this challenge, we have introduced an application and species grid on our primary antibody datasheets to make it easy to simplify identification of the right antibody for your needs.
Learn more here.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles. -
Storage buffer
pH: 7.4 -
Concentration information loading... -
Purity
Tissue culture supernatant -
Clonality
Monoclonal -
Isotype
IgG1 -
Light chain type
kappa -
Research areas
Images
-
Western blot - Anti-ATP6V0D1/P39 antibody (ab56441)
ATP6V0D1/P39 antibody (ab56441) at 1ug/lane + HeLa cell lysate at 25ug/lane.
This image was generated using the ascites version of the product.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-ATP6V0D1/P39 antibody (ab56441)ATP6V0D1/P39 antibody (ab56441) used in immunohistochemistry at 5ug/ml on formalin fixed and paraffin embedded human stomach.
This image was generated using the ascites version of the product.
-
Immunocytochemistry/ Immunofluorescence - Anti-ATP6V0D1/P39 antibody (ab56441)ICC/IF image of ab56441 stained HeLa cells. The cells were 4% formaldehyde fixed (10 min) and then incubated in 1%BSA / 10% normal goat serum / 0.3M glycine in 0.1% PBS-Tween for 1h to permeabilise the cells and block non-specific protein-protein interactions. The cells were then incubated with the antibody (ab56441, 10µg/ml) overnight at +4°C. The secondary antibody (green) was Alexa Fluor® 488 goat anti-mouse IgG (H+L) used at a 1/1000 dilution for 1h. Alexa Fluor® 594 WGA was used to label plasma membranes (red) at a 1/200 dilution for 1h. DAPI was used to stain the cell nuclei (blue) at a concentration of 1.43µM.
This image was generated using the ascites version of the product.
-
Flow Cytometry - Anti-ATP6V0D1/P39 antibody (ab56441)Overlay histogram showing HeLa cells stained with ab56441 (red line). The cells were fixed with 80% methanol (5 min) and then permeabilized with 0.1% PBS-Tween for 20 min. The cells were then incubated in 1x PBS / 10% normal goat serum / 0.3M glycine to block non-specific protein-protein interactions followed by the antibody (ab56441, 1μg/1x106 cells) for 30 min at 22°C. The secondary antibody used was DyLight® 488 goat anti-mouse IgG (H+L) (ab96879) at 1/500 dilution for 30 min at 22°C. Isotype control antibody (black line) was a mix of mouse IgG1 [ICIGG1], (ab91353, 2μg/1x106 cells) used under the same conditions. Acquisition of >5,000 events was performed. This antibody gave a positive signal in HeLa cells fixed with 4%PFA/permeabilized in 0.1% PBS-Tween used under the same conditions.
This image was generated using the ascites version of the product.
