Anti-ATP6V0A1 antibody (ab176858)
Key features and details
- Rabbit polyclonal to ATP6V0A1
- Suitable for: WB, IHC-P
- Reacts with: Human
- Isotype: IgG
Overview
-
Product name
Anti-ATP6V0A1 antibody
See all ATP6V0A1 primary antibodies -
Description
Rabbit polyclonal to ATP6V0A1 -
Host species
Rabbit -
Tested applications
Suitable for: WB, IHC-Pmore details -
Species reactivity
Reacts with: Human
Predicted to work with: Mouse, Rat, Chicken, Cow, Xenopus laevis, Orangutan, Xenopus tropicalis
-
Immunogen
Recombinant fragment corresponding to Human ATP6V0A1 aa 209-387.
Sequence:PVTGDYVHKSVFIIFFQGDQLKNRVKKICEGFRASLYPCPETPQERKEMA SGVNTRIDDLQMVLNQTEDHRQRVLQAAAKNIRVWFIKVRKMKAIYHTLN LCNIDVTQKCLIAEVWCPVTDLDSIQFALRRGTEHSGSTVPSILNRMQTN QTPPTYNKTNKFTYGFQNIVDAYGIGTYR
Database link: Q93050 -
Positive control
- K562 cell lysate; Human fetal kidney tissue.
-
General notes
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Lyophilized:Reconstitute with 200ul distilled sterile water. Please note that if you receive this product in liquid form it has already been reconstituted as described and no further reconstitution is necessary. -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.20
Preservative: 0.02% Sodium azide
Constituents: 98% PBS, 1% BSA -
Concentration information loading... -
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG
Images
-
Anti-ATP6V0A1 antibody (ab176858) at 1/500 dilution + K562 cell lysate
Predicted band size: 96 kDa
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-ATP6V0A1 antibody (ab176858)Immunohistochemical analysis of formalin-fixed paraffin-embedded Human fetal kidney tissue labeling ATP6V0A1 with ab176858 at a 1/100 dilution.

