Anti-AJM1 antibody (ab121654)
Key features and details
- Rabbit polyclonal to AJM1
- Suitable for: WB, ICC/IF, IHC-P
- Reacts with: Mouse, Rat, Human
- Isotype: IgG
Overview
-
Product name
Anti-AJM1 antibody -
Description
Rabbit polyclonal to AJM1 -
Host species
Rabbit -
Tested applications
Suitable for: WB, ICC/IF, IHC-Pmore details -
Species reactivity
Reacts with: Mouse, Rat, Human
Predicted to work with: Rhesus monkey, Gorilla
-
Immunogen
Recombinant fragment corresponding to Human AJM1 aa 307-400.
Sequence:PRPYPSEELSGPSPRRMGGYYAGEVRTFPIQEPPSRSYYGEAPRAYGLPY GPRYVPEEPRAHSTARPFYTEDFGRYRERDVLARTYPHPRSSPAW
-
Positive control
- Hman bone marrow tissue; RT4, U251 MG cell lysates, Human liver tissue lysate
-
General notes
This product was previously labelled as C9orf172
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at -20ºC. -
Storage buffer
pH: 7.20
Preservative: 0.02% Sodium azide
Constituents: 59% PBS, 40% Glycerol (glycerin, glycerine) -
Concentration information loading... -
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Images
-
Immunocytochemistry/ Immunofluorescence - Anti-AJM1 antibody (ab121654)Immunofluorescent staining of Human cell line U-251MG shows positivity in cytoplasm and focal adhesions. Recommended concentration of ab121654 1-4 µg/ml. Cells treated with PFA/Triton X-100.
-
Western blot - Anti-AJM1 antibody (ab121654)Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells)
Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells) -
Western blot - Anti-AJM1 antibody (ab121654)All lanes : Anti-AJM1 antibody (ab121654) at 1/500 dilution
Lane 1 : RT4 cell lysates
Lane 2 : U251 MG cell lysates
Lane 3 : Human Plasma
Lane 4 : Liver tissue lysate
Lane 5 : Tonsil tissue lysate
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-AJM1 antibody (ab121654)ab121654, at 1/150 dilution, staining AJM1 in Human bone marrow tissue by Immunohistochemistry using formalin-fixed, paraffin-embedded tissue.