Anti-Activin Receptor Type IIB/ACVR2B antibody (ab76940)
Key features and details
- Mouse monoclonal to Activin Receptor Type IIB/ACVR2B
- Suitable for: WB, ELISA, Flow Cyt
- Reacts with: Human, Recombinant fragment
- Isotype: IgG2a
Overview
-
Product name
Anti-Activin Receptor Type IIB/ACVR2B antibody
See all Activin Receptor Type IIB/ACVR2B primary antibodies -
Description
Mouse monoclonal to Activin Receptor Type IIB/ACVR2B -
Host species
Mouse -
Tested Applications & Species
See all applications and species dataApplication Species ELISA Recombinant fragmentFlow Cyt HumanWB HumanRecombinant fragment
-
Immunogen
Recombinant fragment corresponding to Human Activin Receptor Type IIB/ACVR2B aa 21-120.
Sequence:RGEAETRECIYYNANWELERTNQSGLERCEGEQDKRLHCYASWANSSGTI ELVKKGCWLDDFNCYDRQECVATEENPQVYFCCCEGNFCNERFTHLPEAG
Database link: NP_001097 -
Positive control
- Lysate from 293T cells transfected with Activin Receptor Type IIB/ACVR2B
-
General notes
This product was changed from ascites to tissue culture supernatant on 22/03/2019. Please note that the dilutions may need to be adjusted accordingly. If you have any questions, please do not hesitate to contact our scientific support team.
This product was previously labelled as Activin Receptor Type IIB
The Life Science industry has been in the grips of a reproducibility crisis for a number of years. Abcam is leading the way in addressing the problem with our range of recombinant monoclonal antibodies and knockout edited cell lines for gold-standard validation.
One factor contributing to the crisis is the use of antibodies that are not suitable. This can lead to misleading results and the use of incorrect data informing project assumptions and direction. To help address this challenge, we have introduced an application and species grid on our primary antibody datasheets to make it easy to simplify identification of the right antibody for your needs.
Learn more here.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles. -
Storage buffer
pH: 7.40
Constituent: 2.68% PBS -
Concentration information loading... -
Purity
Tissue culture supernatant -
Clonality
Monoclonal -
Isotype
IgG2a -
Light chain type
kappa -
Research areas
Images
-
Western blot - Anti-Activin Receptor Type IIB/ACVR2B antibody (ab76940)All lanes : Anti-Activin Receptor Type IIB/ACVR2B antibody (ab76940)
Lane 1 : IIB/ACVR2B transfected 293T cell lysate
Lane 2 : Non-transfected 293T cell lysate
Predicted band size: 58 kDa
-
Flow Cytometry - Anti-Activin Receptor Type IIB/ACVR2B antibody (ab76940)Overlay histogram showing HeLa cells stained with ab76940 (red line). The cells were fixed with 80% methanol (5 min) and incubated in 1x PBS / 10% normal goat serum / 0.3M glycine to block non-specific protein-protein interactions. The cells were then incubated with the antibody (ab76940, 0.5µg/1x106 cells) for 30 min at 22ºC. The secondary antibody used was DyLight® 488 goat anti-mouse IgG (H+L) (ab96879) at 1/500 dilution for 30 min at 22ºC. Isotype control antibody (black line) was mouse IgG2a [ICIGG2A] (ab91361, 1µg/1x106 cells) used under the same conditions. Acquisition of >5,000 events was performed.
Please note that Abcam do not have any data for use of this antibody on non-fixed cells. We welcome any customer feedback.This image was generated using the ascites version of the product.
-
Western blot - Anti-Activin Receptor Type IIB/ACVR2B antibody (ab76940)Anti-Activin Receptor Type IIB/ACVR2B antibody (ab76940) at 1/500 dilution + immunogen (GST-tagged 100aa recombinant fragment) at 0.2 µg
Secondary
Goat anti-Mouse IgG (H&L) HRP-conjugated at 1/5000 dilution
Predicted band size: 58 kDa
Observed band size: 37 kDa why is the actual band size different from the predicted?MW of GST tag alone: 26 kDa
This image was generated using the ascites version of the product.
-
ELISA - Anti-Activin Receptor Type IIB/ACVR2B antibody (ab76940)Detection limit for recombinant GST tagged ACVR2B is 0.1 ng/ml as a capture antibody.
