Call: +7 771 977 66 65, +7 705 421 2277
Sign in or Register
My basket

Astana Biomed Group, an authorized Abcam distributor in Central Asia

Abiomed homepage

  • Categories
    Signal Transduction
    Cancer
    Epigenetics and Nuclear Signaling
    Immunology
    Cell Biology
    Cardiovascular
    Neuroscience
    Tags & Cell Markers
    Kits/ Lysates/ Other
    Developmental Biology
    Microbiology
    Biochemicals
    Secondary antibodies
    Isotype/Loading Controls
    Antibody Arrays
  • About us
  • Partners
  • Contact
    Address

    Saryarka 32, 18, 010000, Astana city, Kazakhstan

    Telephone +7 771 977 66 65, +7 705 421 2277

    Email

    laboratory@ctlab.kz, orders@abiomed.kz

Back to category
Signal Transduction Cytoskeleton / ECM Cytoskeleton Microfilaments Actin etc Actin Binding Proteins

Anti-Activin Receptor Type IIB/ACVR2B antibody (ab76940)

Price and availability

381 945 ₸

Availability

Order now and get it on Wednesday March 10, 2021

Anti-Activin Receptor Type IIB/ACVR2B antibody (ab76940)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)

Key features and details

  • Mouse monoclonal to Activin Receptor Type IIB/ACVR2B
  • Suitable for: WB, ELISA, Flow Cyt
  • Reacts with: Human, Recombinant fragment
  • Isotype: IgG2a

You may also be interested in

Product image
Anti-LMCD1 antibody [EPR11444] (ab179454)
Product image
Anti-DIAPH2/DIA antibody (ab201205)
Product image
Anti-MIM antibody (ab78161)
Product image
Recombinant Human EPB41 protein (ab114654)

Overview

  • Product name

    Anti-Activin Receptor Type IIB/ACVR2B antibody
    See all Activin Receptor Type IIB/ACVR2B primary antibodies
  • Description

    Mouse monoclonal to Activin Receptor Type IIB/ACVR2B
  • Host species

    Mouse
  • Tested Applications & Species

    Application Species
    ELISA
    Recombinant fragment
    Flow Cyt
    Human
    WB
    Human
    Recombinant fragment
    See all applications and species data
  • Immunogen

    Recombinant fragment corresponding to Human Activin Receptor Type IIB/ACVR2B aa 21-120.
    Sequence:

    RGEAETRECIYYNANWELERTNQSGLERCEGEQDKRLHCYASWANSSGTI ELVKKGCWLDDFNCYDRQECVATEENPQVYFCCCEGNFCNERFTHLPEAG


    Database link: NP_001097
    Run BLAST with BLAST the sequence with ExPASy Run BLAST with BLAST the sequence with NCBI
  • Positive control

    • Lysate from 293T cells transfected with Activin Receptor Type IIB/ACVR2B
  • General notes

    This product was changed from ascites to tissue culture supernatant on 22/03/2019. Please note that the dilutions may need to be adjusted accordingly. If you have any questions, please do not hesitate to contact our scientific support team.

     This product was previously labelled as Activin Receptor Type IIB

     

    The Life Science industry has been in the grips of a reproducibility crisis for a number of years. Abcam is leading the way in addressing the problem with our range of recombinant monoclonal antibodies and knockout edited cell lines for gold-standard validation.

    One factor contributing to the crisis is the use of antibodies that are not suitable. This can lead to misleading results and the use of incorrect data informing project assumptions and direction. To help address this challenge, we have introduced an application and species grid on our primary antibody datasheets to make it easy to simplify identification of the right antibody for your needs.

    Learn more here.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
  • Storage buffer

    pH: 7.40
    Constituent: 2.68% PBS
  • Concentration information loading...
  • Purity

    Tissue culture supernatant
  • Clonality

    Monoclonal
  • Isotype

    IgG2a
  • Light chain type

    kappa
  • Research areas

    • Signal Transduction
    • Cytoskeleton / ECM
    • Cytoskeleton
    • Microfilaments
    • Actin etc
    • Actin Binding Proteins
    • Signal Transduction
    • Protein Phosphorylation
    • Ser / Thr Kinases
    • Other Kinases
    • Stem Cells
    • Signaling Pathways
    • TGF beta
    • Surface Molecules

Images

  • Western blot - Anti-Activin Receptor Type IIB/ACVR2B antibody (ab76940)
    Western blot - Anti-Activin Receptor Type IIB/ACVR2B antibody (ab76940)
    All lanes : Anti-Activin Receptor Type IIB/ACVR2B antibody (ab76940)

    Lane 1 : IIB/ACVR2B transfected 293T cell lysate
    Lane 2 : Non-transfected 293T cell lysate

    Predicted band size: 58 kDa

  • Flow Cytometry - Anti-Activin Receptor Type IIB/ACVR2B antibody (ab76940)
    Flow Cytometry - Anti-Activin Receptor Type IIB/ACVR2B antibody (ab76940)

    Overlay histogram showing HeLa cells stained with ab76940 (red line). The cells were fixed with 80% methanol (5 min) and incubated in 1x PBS / 10% normal goat serum / 0.3M glycine to block non-specific protein-protein interactions. The cells were then incubated with the antibody (ab76940, 0.5µg/1x106 cells) for 30 min at 22ºC. The secondary antibody used was DyLight® 488 goat anti-mouse IgG (H+L) (ab96879) at 1/500 dilution for 30 min at 22ºC. Isotype control antibody (black line) was mouse IgG2a [ICIGG2A] (ab91361, 1µg/1x106 cells) used under the same conditions. Acquisition of >5,000 events was performed.
    Please note that Abcam do not have any data for use of this antibody on non-fixed cells. We welcome any customer feedback.

    This image was generated using the ascites version of the product.

  • Western blot - Anti-Activin Receptor Type IIB/ACVR2B antibody (ab76940)
    Western blot - Anti-Activin Receptor Type IIB/ACVR2B antibody (ab76940)
    Anti-Activin Receptor Type IIB/ACVR2B antibody (ab76940) at 1/500 dilution + immunogen (GST-tagged 100aa recombinant fragment) at 0.2 µg

    Secondary
    Goat anti-Mouse IgG (H&L) HRP-conjugated at 1/5000 dilution

    Predicted band size: 58 kDa
    Observed band size: 37 kDa
    why is the actual band size different from the predicted?



    MW of GST tag alone: 26 kDa

    This image was generated using the ascites version of the product.

  • ELISA - Anti-Activin Receptor Type IIB/ACVR2B antibody (ab76940)
    ELISA - Anti-Activin Receptor Type IIB/ACVR2B antibody (ab76940)

    Detection limit for recombinant GST tagged ACVR2B is 0.1 ng/ml as a capture antibody.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Alternative products to Anti-Activin Receptor Type IIB/ACVR2B antibody (ab76940)

  •  
  • Product image

    Anti-Activin Receptor Type IIB/ACVR2B antibody (ab128544)

    Applications: IHC-P, WB

  •  
  • Product image

    Anti-Activin Receptor Type IIB/ACVR2B antibody [EPR10739] (ab180185)

    Applications: IP, WB

Get resources and offers direct to your inbox Sign up
© 2021 Astana Biomed Group LLP. All rights reserved.