Anti-ACTH antibody (ab74976)
Key features and details
- Rabbit polyclonal to ACTH
- Suitable for: IHC-P
- Reacts with: Mouse, Rat, Human
- Isotype: IgG
Overview
-
Product name
Anti-ACTH antibody
See all ACTH primary antibodies -
Description
Rabbit polyclonal to ACTH -
Host species
Rabbit -
Tested applications
Suitable for: IHC-Pmore details -
Species reactivity
Reacts with: Mouse, Rat, Human
Predicted to work with: Sheep, Goat, Chicken, Guinea pig, Cow, Dog, Chimpanzee, Macaque monkey, Orangutan
-
Immunogen
Synthetic peptide corresponding to ACTH aa 1-39. This corresponds to amino acids 138-176 of the precursor POMC.
Sequence:SYSMEHFRWGKPVGKKRRPVKVYPNGAEDESAEAFPLEF
Database link: P01189 -
General notes
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles. -
Storage buffer
Preservative: 0.02% Sodium azide -
Concentration information loading... -
Purity
Protein A purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Images
-
Formalin-fixed, paraffin-embedded mouse brain tissue stained for ACTH with ab74976 (1/100 dilution) in immunohistochemical analysis. DAB (brown) and Hematoxylin (blue)staining.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-ACTH antibody (ab74976) Image from Zhang Z et al, J Biol Chem. 2010 Nov 5;285(45):34718-28. Epub 2010 Aug 31, Fig 4. DOI 10.1074/jbc.M110.126441ab74976 staining ACTH in P0 Pitx2-Cre/Dicer1 mutant mice pituitary tissue by Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections).
Samples were fixed in 4% paraformaldehyde, dehydrated, and embedded in paraffin wax. Sections were cut (7 µm) and stained with H&E. Immunohistochemistry was performed on 7-µm paraffin sections stained by an indirect immunoperoxidase method. Peroxidase activity was visualized with AEC stain kit. ab74976 diluted 1/200. Secondary antibodies conjugated with biotin were used at 1/150 dilution.

