Call: +7 771 977 66 65, +7 705 421 2277
Sign in or Register
My basket

Astana Biomed Group, an authorized Abcam distributor in Central Asia

Abiomed homepage

  • Categories
    Signal Transduction
    Cancer
    Epigenetics and Nuclear Signaling
    Immunology
    Cell Biology
    Cardiovascular
    Neuroscience
    Tags & Cell Markers
    Kits/ Lysates/ Other
    Developmental Biology
    Microbiology
    Biochemicals
    Secondary antibodies
    Isotype/Loading Controls
    Antibody Arrays
  • About us
  • Partners
  • Contact
    Address

    Saryarka 32, 18, 010000, Astana city, Kazakhstan

    Telephone +7 771 977 66 65, +7 705 421 2277

    Email

    laboratory@ctlab.kz, orders@abiomed.kz

Back to category
Signal Transduction Growth Factors/Hormones Hormones

Anti-ACTH antibody (ab74976)

Price and availability

301 536 ₸

Availability

Order now and get it on Wednesday February 24, 2021

Anti-ACTH antibody (ab74976)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)

Key features and details

  • Rabbit polyclonal to ACTH
  • Suitable for: IHC-P
  • Reacts with: Mouse, Rat, Human
  • Isotype: IgG

You may also be interested in

Anti-pan Endothelin antibody [3G10] (ab20860)
Product image
Anti-Thyroglobulin antibody [EPR3614(2)] - BSA and Azide free (ab248992)
Product image
Anti-ACTH antibody [AH26 + 57] - BSA and Azide free (ab212738)
Anti-Exendin 4 antibody [20] (ab23407)

Overview

  • Product name

    Anti-ACTH antibody
    See all ACTH primary antibodies
  • Description

    Rabbit polyclonal to ACTH
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Mouse, Rat, Human
    Predicted to work with: Sheep, Goat, Chicken, Guinea pig, Cow, Dog, Chimpanzee, Macaque monkey, Orangutan
  • Immunogen

    Synthetic peptide corresponding to ACTH aa 1-39. This corresponds to amino acids 138-176 of the precursor POMC.
    Sequence:

    SYSMEHFRWGKPVGKKRRPVKVYPNGAEDESAEAFPLEF


    Database link: P01189
    Run BLAST with BLAST the sequence with ExPASy Run BLAST with BLAST the sequence with NCBI
  • General notes

    Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.

    Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.

    We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.

    In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.

    We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.

    Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.

    Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
  • Storage buffer

    Preservative: 0.02% Sodium azide
  • Concentration information loading...
  • Purity

    Protein A purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

    • Neuroscience
    • Neurotransmitter
    • Neuropeptides
    • Hormones
    • Signal Transduction
    • Growth Factors/Hormones
    • Hormones
    • Neuroscience
    • Endocrine system
    • Hypothalamic pituitary adrenal axis
    • Cancer
    • Tumor biomarkers
    • Hormones
    • Cancer
    • Cancer Metabolism
    • Metabolic signaling pathway
    • Hormone biosynthesis
    • Metabolism
    • Pathways and Processes
    • Endocrine metabolism
    • Hormone biosynthesis
    • Metabolism
    • Types of disease
    • Obesity
    • Metabolism
    • Types of disease
    • Cancer

Images

  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-ACTH antibody (ab74976)
    Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-ACTH antibody (ab74976)

    Formalin-fixed, paraffin-embedded mouse brain tissue stained for ACTH with ab74976 (1/100 dilution) in immunohistochemical analysis. DAB (brown) and Hematoxylin (blue)staining.

  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-ACTH antibody (ab74976)
    Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-ACTH antibody (ab74976) Image from Zhang Z et al, J Biol Chem. 2010 Nov 5;285(45):34718-28. Epub 2010 Aug 31, Fig 4. DOI 10.1074/jbc.M110.126441

    ab74976 staining ACTH in P0 Pitx2-Cre/Dicer1 mutant mice pituitary tissue by Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections).

    Samples were fixed in 4% paraformaldehyde, dehydrated, and embedded in paraffin wax. Sections were cut (7 µm) and stained with H&E. Immunohistochemistry was performed on 7-µm paraffin sections stained by an indirect immunoperoxidase method. Peroxidase activity was visualized with AEC stain kit. ab74976 diluted 1/200. Secondary antibodies conjugated with biotin were used at 1/150 dilution.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Alternative products to Anti-ACTH antibody (ab74976)

  •  
  • Anti-ACTH antibody [M31241] (ab49585)

    Applications:

  •  
  • Product image

    Anti-ACTH antibody [AH26] - BSA and Azide free (ab212734)

    Applications: IHC-P

  •  
  • Product image

    Anti-ACTH antibody [57] - N-terminal (ab233954)

    Applications: IHC-P

  •  
  • Product image

    Anti-ACTH antibody [SPM501] (ab231425)

    Applications: IHC-P

  •  
  • Product image

    Anti-ACTH antibody [AH26 + 57] - N-terminal (ab199007)

    Applications: IHC-P

  •  
  • Product image

    Anti-ACTH antibody [57] - BSA and Azide free (ab212736)

    Applications: IHC-P

  •  
  • HRP Anti-ACTH antibody [6Y8] - N-terminal (ab187929)

    Applications:

  •  
  • Product image

    Anti-ACTH antibody [AH26 + 57] - BSA and Azide free (ab212738)

    Applications: IHC-P

Clear all

Recently viewed products

  •  
  • Product image

    Anti-HAS1 antibody (ab198846)

  •  
  • Product image

    Anti-HSF2 antibody (ab101844)

  •  
  • Product image

    Recombinant human FGFR1 protein (Active) (ab168696)

  •  
  • Product image

    Anti-MR1 antibody (ab222143)

  •  
  • Product image

    Recombinant Human COX IV protein (ab112273)

  •  
  • Product image

    Recombinant human cGKI protein (ab80375)

Get resources and offers direct to your inbox Sign up
© 2021 Astana Biomed Group LLP. All rights reserved.