AKT1 + PKN2 peptide substrate (ab204873)
Key features and details
- Suitable for: HPLC, Functional Studies
-
Product name
AKT1 + PKN2 peptide substrate -
Animal free
No -
Nature
Synthetic -
-
Sequence
[protein fragment, 39 aa] -
Additional sequence information
The 39 amino acids of PDKtide peptide sequence is derived from two human proteins: residues 1-14 are based on AKT1 (307-320) and residues 16-39 are based on PKN2/PRK2 (961-984).
-
Preparation and Storage
-
Stability and Storage
Shipped at 4°C. Store at -20°C. Avoid freeze / thaw cycle.