ACTH (1-39) (human), endogenous melanocortin receptor 2 (MC2) agonist (ab141151)
Key features and details
- Potent, endogenous melanocortin receptor 2 (MC2) agonist
- CAS Number: 12279-41-3
- Purity: > 95%
- Soluble in water
- Form / State: Solid
- Source: Synthetic
Overview
-
Product name
ACTH (1-39) (human), endogenous melanocortin receptor 2 (MC2) agonist -
Description
Potent, endogenous melanocortin receptor 2 (MC2) agonist -
Biological description
Potent, endogenous melanocortin receptor 2 (MC2) agonist (EC50 = 57 pM). Component of the hypothalamo-pituitary-adrenal (HPA) stress axis with an important role in the pathogenesis of obesity and metabolic syndrome.
-
Purity
> 95% -
CAS Number
12279-41-3 -
Chemical structure
Properties
-
Molecular weight
4541.11 -
Molecular formula
C207H308N56O58S -
Sequence
SYSMEHFRWGKPVGKKRRPVKVYPNGAEDESAEAFPLEF -
PubChem identifier
57339642 -
Storage instructions
Store at -20°C. Store under desiccating conditions. The product can be stored for up to 12 months. -
Solubility overview
Soluble in water -
Handling
This product is supplied in one (or more) pack size which is freeze dried. Therefore the contents may not be readily visible, as they can coat the bottom or walls of the vial. Please see our FAQs and information page for more details on handling.
Wherever possible, you should prepare and use solutions on the same day. However, if you need to make up stock solutions in advance, we recommend that you store the solution as aliquots in tightly sealed vials at -20°C. Generally, these will be useable for up to one week. Before use, and prior to opening the vial we recommend that you allow your product to equilibrate to room temperature for at least 1 hour.
Need more advice on solubility, usage and handling? Please visit our frequently asked questions (FAQ) page for more details.
-
Source
Synthetic
-
Research areas