Stichodactyla Toxin, voltage-dependent K+ channel blocker (ab141864)
Key features and details
- Highly potent voltage-dependent K+ channel blocker
- CAS Number: 172450-46-3
- Purity: > 98%
Soluble in water
- Form / State: Solid
- Source: Synthetic
Overview
-
Product name
Stichodactyla Toxin, voltage-dependent K+ channel blocker -
Description
Highly potent voltage-dependent K+ channel blocker -
Biological description
Highly potent voltage-dependent K+ channel blocker (IC50 values are 16,11 and 312 pM and 0.3-6, 9, 12, 30 and 170 nM for KV1.1, KV1.3, KV1.4, KV1.2, KV3.2, KV1.7 KCa3.1 and KV1.6 respectively). Competes with Dendrotoxin I (Asc 1794) and α-Dendrotoxin (Asc 1791) to bind to synaptosomal membranes of rat brain (IC50 values are 1 nM and 20 pM respectively). Shows immunomodulatory effects in vivo. -
Purity
> 98% -
CAS Number
172450-46-3 -
Chemical structure

Properties
-
Molecular weight
4055.00 -
Molecular formula
C169H274N54O48S7 -
Sequence
RSCIDTIPKSRCTAFQCKHSMKYRLSFCRKTCGTC (Modifications: Disulfide bonds: 3-35, 12-28, 17-32) -
Storage instructions
Store at -20°C. Store under desiccating conditions. The product can be stored for up to 12 months. -
Solubility overview
Soluble in water
-
Handling
Wherever possible, you should prepare and use solutions on the same day. However, if you need to make up stock solutions in advance, we recommend that you store the solution as aliquots in tightly sealed vials at -20°C. Generally, these will be useable for up to one week. Before use, and prior to opening the vial we recommend that you allow your product to equilibrate to room temperature for at least 1 hour.
Need more advice on solubility, usage and handling? Please visit our frequently asked questions (FAQ) page for more details.
-
Source
Synthetic
-
Research areas