Recombinant Woodchuck Interferon gamma protein (His tag) (ab225661)
Key features and details
- Expression system: Yeast
- Purity: > 90% SDS-PAGE
- Tags: His tag N-Terminus
- Suitable for: MS, SDS-PAGE
-
Product name
Recombinant Woodchuck Interferon gamma protein (His tag)
See all Interferon gamma proteins and peptides -
Purity
> 90 % SDS-PAGE. -
Expression system
Yeast -
Accession
-
Protein length
Full length protein -
Animal free
No -
Nature
Recombinant -
-
Species
Woodchuck -
Sequence
QDTVNKEIEDLKGYFNASNSNVSDGGSLFLDILDKWKEESDKKVIQSQIV SFYFKLFEHLKDNKIIQRSMDTIKGDLFAKFFNSSTNKLQDFLKVSQVQV NDLKIQRKAVSELKKVMNDLLPHSTLRKRKRSQSSIRGRRASK -
Predicted molecular weight
19 kDa including tags -
Amino acids
24 to 166 -
Tags
His tag N-Terminus -
Additional sequence information
Marmota monax (Woodchuck) protein. This product is the mature full length protein from aa 24 to 166. The signal peptide is not included.
-
Preparation and Storage
-
Stability and Storage
Shipped at 4°C. Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.
Constituents: 50% Glycerol (glycerin, glycerine), Tris buffer
Images
-
SDS-PAGE - Recombinant Woodchuck Interferon gamma protein (His tag) (ab225661)
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) analysis of ab225661 with 5% enrichment gel and 15% separation gel.
-
Mass Spectrometry - Recombinant Woodchuck Interferon gamma protein (His tag) (ab225661)Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS analysis result of ab225661 could indicate that this peptide derived from Yeast-expressed Marmota monax (Woodchuck) Interferon gamma.
-
Mass Spectrometry - Recombinant Woodchuck Interferon gamma protein (His tag) (ab225661)Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS analysis result of ab225661 could indicate that this peptide derived from Yeast-expressed Marmota monax (Woodchuck) Interferon gamma.
