Recombinant staphylococcus aureus hlgC protein (Active) (ab233606)
Key features and details
- Expression system: Escherichia coli
- Active: Yes
- Suitable for: Functional Studies, WB, SDS-PAGE
-
Product name
Recombinant staphylococcus aureus hlgC protein (Active) -
Biological activity
Cytotoxicity can be detected in human neutrophils when used in combination with hIg B in a concentration range of 0.03-200 nM.
-
Expression system
Escherichia coli -
Accession
-
Protein length
Full length protein -
Animal free
No -
Nature
Recombinant -
-
Species
Staphylococcus aureus -
Sequence
ANDTEDIGKGSDIEIIKRTEDKTSNKWGVTQNIQFDFVKDKKYNKDALIL KMQGFISSRTTYYNYKKTNHVKAMRWPFQYNIGLKTNDKYVSLINYLPKN KIESTNVSQTLGYNIGGNFQSAPSLGGNGSFNYSKSISYTQQNYVSEVEQ QNSKSVLWGVKANSFATESGQKSAFDSDLFVGYKPHSKDPRDYFVPDSEL PPLVQSGFNPSFIATVSHEKGSSDTSEFEITYGRNMDVTHAIKRSTHYGN SYLDGHRVHNAFVNRNYTVKYEVNWKTHEIKVKGQN -
Predicted molecular weight
33 kDa -
Amino acids
30 to 315 -
Additional sequence information
This product is the mature full length protein from aa 32 to 315. The signal peptide is not included.
-
Images
-
Functional Studies - Recombinant staphylococcus aureus hlgC protein (Active) (ab233606)
HL-60 (Human promyelocytic leukemia cell line) was differentiated into neutrophils by treatment with DMSO. Neutrophils were incubated with serial dilutions of hlg B tag-free and ab233606 at equimolar concentration for 3 hours at 37°C with 5% CO2 and 95% humidity. Cellular viability was determined by adding XTT and incubation for additional 16 hours. OD’s were determined in the supernatants at 470/690 nm. Red squares represent (ab233606) and blue squares represent hIgC his-tag. EC50 was found to be 2.84 nM for ab233606 and 5.53 nM for hIgC his-tag.
-
Western blot - Recombinant staphylococcus aureus hlgC protein (Active) (ab233606)All lanes : Polyclonal hIgC antibody at 0.5 µg/ml
Lane 1 :Recombinant staphylococcus aureus hlgC protein (Active) (ab233606) at 0.1 µg
Lane 2 :Recombinant staphylococcus aureus hlgC protein (Active) (ab233606) at 0.05 µg
Lane 3 :Recombinant staphylococcus aureus hlgC protein (Active) (ab233606) at 0.025 µg
Secondary
All lanes : Anti-rabbit IgG-horseradish peroxidase (HRP) conjugateTMB substrate
-
SDS-PAGE - Recombinant staphylococcus aureus hlgC protein (Active) (ab233606)SDS-PAGE analysis of ab233606 under denaturing and reducing conditions.
Lane 1: 1 µg
Lane 2: 5 µg