Recombinant staphylococcus aureus hlgB protein (Active) (ab233597)
Key features and details
- Expression system: Escherichia coli
- Active: Yes
- Suitable for: WB, Functional Studies, SDS-PAGE
-
Product name
Recombinant staphylococcus aureus hlgB protein (Active)
See all hlgB proteins and peptides -
Biological activity
Cytotoxicity can be detected in human neutrophils when used in combination with hIg A or hlg C.
-
Expression system
Escherichia coli -
Accession
-
Protein length
Full length protein -
Animal free
No -
Nature
Recombinant -
-
Species
Staphylococcus aureus -
Sequence
MKMNKLVKSSVATSMALLLLSGTANAEGKITPVSVKKVDDKVTLYKTTAT ADSDKFKISQILTFNFIKDKSYDKDTLVLKATGNINSGFVKPNPNDYDFS KLYWGAKYNVSISSQSNDSVNVVDYAPKNQNEEFQVQNTLGYTFGGDISI SNGLSGGLNGNTAFSETINYKQESYRTTLSRNTNYKNVGWGVEAHKIMNN GWGPYGRDSFHPTYGNELFLAGRQSSAYAGQNFIAQHQMPLLSRSNFNPE FLSVLSHRQDGAKKSKITVTYQREMDLYQIRWNGFYWAGANYKNFKTRTF KSTYEIDWENHKVKLLDTKETENNK -
Predicted molecular weight
35 kDa -
Amino acids
1 to 325
-
Preparation and Storage
- Gamma hemolysin component B
- H gamma 1
- H gamma I
Images
-
Cellular activity - Recombinant staphylococcus aureus hlgB protein (Active) (ab233597)
HL-60 (Human promyelocytic leukemia cell line) was differentiated into neutrophils by treatments with DMSO. Neutrophils were incubated with serial dilutions of rhIg A and rhIg B at equimolar concentration for 3 hours at 37°C with 5% CO2 and 95% humidity. Cellular viability was determined by adding XTT and incubation for additional 16 hours. Cells were centrifuged and the OD determined in the supernatants at 470/690 nm. Cells only represented by green circles.
EC50 value was found to be 1.10 nM for ab233597 in combination with hIgA.
-
Western blot - Recombinant staphylococcus aureus hlgB protein (Active) (ab233597)All lanes : Anti-hIgGB polyclonal antibody at 0.5 µg/ml
Lane 1 :Recombinant staphylococcus aureus hlgB protein (Active) (ab233597) at 0.2 µg/ml
Lane 2 :Recombinant staphylococcus aureus hlgB protein (Active) (ab233597) at 0.1 µg/ml
Lane 3 :Recombinant staphylococcus aureus hlgB protein (Active) (ab233597) at 0.05 µg/ml
Lane 4 :Recombinant staphylococcus aureus hlgB protein (Active) (ab233597) at 0.025 µg/ml
Secondary
All lanes : Anti-rabbit IgG-HRPTMB substrate
-
SDS-PAGE - Recombinant staphylococcus aureus hlgB protein (Active) (ab233597)SDS-PAGE - Recombinant staphylococcus aureus hlgB protein (Active) (ab233597)
Lane 1: ab233597 at 1 µg.
Lane 2: ab233597 at 5 µg.
Denaturing and reducing conditions.
