Recombinant Salmonella typhimurium PrgI protein (His tag) (ab237560)
Key features and details
- Expression system: Escherichia coli
- Purity: > 90% SDS-PAGE
- Tags: His tag N-Terminus
- Suitable for: MS, SDS-PAGE
-
Product name
Recombinant Salmonella typhimurium PrgI protein (His tag) -
Purity
> 90 % SDS-PAGE. -
Expression system
Escherichia coli -
Accession
-
Protein length
Full length protein -
Animal free
No -
Nature
Recombinant -
-
Species
Salmonella typhimurium -
Sequence
MATPWSGYLDDVSAKFDTGVDNLQTQVTEALDKLAAKPSDPALLAAYQSK LSEYNLYRNAQSNTVKVFKDIDAAIIQNFR -
Predicted molecular weight
25 kDa including tags -
Amino acids
1 to 80 -
Tags
His tag N-Terminus -
Additional sequence information
Strain LT2 / SGSC1412 / ATCC 700720. N-terminal 6xHis-SUMO-tag.
-
Preparation and Storage
-
Stability and Storage
Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle.
Constituents: Tris buffer, 50% Glycerol (glycerin, glycerine)
Images
-
SDS-PAGE - Recombinant Salmonella typhimurium PrgI protein (His tag) (ab237560)
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) analysis with 5% enrichment gel and 15% separation gel of ab237560.
-
Mass Spectrometry - Recombinant Salmonella typhimurium PrgI protein (His tag) (ab237560)Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of ab237560 could indicate that this peptide derived from E.coli-expressed Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) prgI.
-
Mass Spectrometry - Recombinant Salmonella typhimurium PrgI protein (His tag) (ab237560)Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of ab237560 could indicate that this peptide derived from E.coli-expressed Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) prgI.