Recombinant Rubella Virus capsid nucleoprotein protein (His tag) (ab256430)
Key features and details
- Expression system: HEK 293 cells
- Tags: His tag C-Terminus
- Suitable for: Functional Studies, SDS-PAGE
-
Product name
Recombinant Rubella Virus capsid nucleoprotein protein (His tag)
See all Rubella Virus capsid proteins and peptides -
Expression system
HEK 293 cells -
Accession
-
Protein length
Full length protein -
Animal free
No -
Nature
Recombinant -
-
Species
Rubella virus -
Sequence
MASTTPITMEDLQKALEAQSRALRAELAAGASQSRRPRPPRQRDSSTSGD DSGRDSGGPRRRRGNRGRGQRRDWSRAPPPPEERQETRSQTPAPKPSRAP PQQPQPPRMQTGRGGSAPRPELGPPTNPFQAAVARGLRPPLHDPDTEAPT EACVTSWLWSEGEGAVFYRVDLHFTNLGTPPLDEDGRWDPALMYNPCGPE PPAHVVRAYNQPAGDVRGVWGKGERTYAEQDFRVGGTRWHRLLRMPVRGL DGDSAPLPPHTTERIETRSARHPWRIRFGAPQAFLAGLLLATVAVGTARA -
Amino acids
1 to 300 -
Tags
His tag C-Terminus -
Additional sequence information
NP_0628841.1. Strain F-Therien. C-terminal 10 amino acid Gly-Ser linker connecting the protein to a 6xHis tag.
-
-
Description
Recombinant Rubella Virus capsid protein (His tag)
Preparation and Storage
-
Stability and Storage
Shipped on Dry Ice. Store at -80°C. Avoid freeze / thaw cycle.
pH: 7
Constituents: 0.32% Tris HCl, 0.29% Sodium chloride, 0.5% Sodium lauryl sulfate
Sterile filtered.
Removal of SDS will result in a concentration-dependent aggregation of the protein.
Images
-
SDS-PAGE - Recombinant Rubella Virus capsid protein (ab256430)
SDS-PAGE analysis of ab256430 under reducing conditions.
-
Functional Studies - Recombinant Rubella Virus capsid protein (ab256430)Detection of anti-Rubella IgG in human serum.
Plate coated with 50 ng/well of antigens. NP = ab256430
Antigens coated in bicarbonate-carbonate buffer pH 9.6 for 1 hour at RT. Blocked with 2% BSA/PBS for 2 hours at RT.
Washed x3 with Tris washing buffer.
Serum samples (Public Health England) diluted 1/201 in 1% BSA in PBS-T.
Secondary antibody was anti-Human-IgG-HRP diluted 1/10000 in 1% BSA in PBS-T. TMB detection.
-
Functional Studies - Recombinant Rubella Virus capsid protein (ab256430)Detection of anti-Rubella IgM in human serum.
Plate coated with 100 ng/well of antigens. NP = ab256430
Washed x3 with Tris washing buffer.
Serum samples (Public Health England) diluted 1/201 in 1% BSA in PBS-T + 4% IgG/RF stripper. After standing for 30 minutes the diluted samples were centrifuged at 17,000 x g for 1 minute and the supernatant used for ELISA.
Secondary antibody was anti-Human-IgM-HRP diluted 1/10000 in 1% BSA in PBS-T. TMB detection.
