Recombinant rat Prolactin/PRL protein (Active) (ab243235)
Key features and details
- Expression system: Escherichia coli
- Purity: > 98% SDS-PAGE
- Endotoxin level:
- Active: Yes
- Suitable for: SDS-PAGE, Functional Studies, HPLC
-
Product name
Recombinant rat Prolactin/PRL protein (Active)
See all Prolactin/PRL proteins and peptides -
Biological activity
Fully biologically active when compared to standard. The ED50 as determined by a cell proliferation assay using rat Nb2-11 cells is less than 1.0 ng/ml, corresponding to a specific activity of >1.0x106 IU/mg.
-
Purity
> 98 % SDS-PAGE.
Purity >98% as determined by SDS-PAGE and HPLC. -
Endotoxin level
Expression system
Escherichia coliAccession
Protein length
Full length proteinAnimal free
NoNature
Recombinant-
Species
Rat -
Sequence
LPVCSGGDCQTPLPELFDRVVMLSHYIHTLYTDMFIEFDKQYVQDREFIA KAINDCPTSSLATPEDKEQAQKVPPEVLLNLILSLVHSWNDPLFQLITGL GGIHEAPDAIISRAKEIEEQNKRLLEGIEKIISQAYPEAKGNEIYLVWSQ LPSLQGVDEESKDLAFYNNIRCLRRDSHKVDNYLKFLRCQIVHKNNC -
Predicted molecular weight
23 kDa -
Amino acids
30 to 226 -
Additional sequence information
This product is the mature full length protein from aa 30 to 226. The signal peptide is not included.
Associated products
Specifications
Our Abpromise guarantee covers the use of ab243235 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
SDS-PAGE
Functional Studies
HPLC
-
Form
Lyophilized -
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle.
Constituent: PBS
0.2 µm filteredThis product is an active protein and may elicit a biological response in vivo, handle with caution.
-
ReconstitutionBriefly centrifuge prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/ml. Stock solutions should be apportioned into working aliquots and stored at -20 °C or below. Further dilutions should be made in appropriate buffered solutions.
General Info
-
Alternative names
- Decidual prolactin
- GHA1
- Growth hormone A1
see all -
Relevance
Various hormones are secreted from the anterior pituitary during development and growth. Prolactin is a growth factor secreted by the anterior pituitary that is necessary for the proliferation and differentiation of the mammary glands. -
Cellular localization
Secreted
Images
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
References (0)
ab243235 has not yet been referenced specifically in any publications.
Preparation and Storage
-
Alternative names
- Decidual prolactin
- GHA1
- Growth hormone A1
see all -
Relevance
Various hormones are secreted from the anterior pituitary during development and growth. Prolactin is a growth factor secreted by the anterior pituitary that is necessary for the proliferation and differentiation of the mammary glands. -
Cellular localization
Secreted