Recombinant pig IP10 protein (Active) (ab210921)
Key features and details
- Expression system: Yeast
- Purity: > 95% SDS-PAGE
- Active: Yes
- Suitable for: SDS-PAGE, Functional Studies
-
Product name
Recombinant pig IP10 protein (Active)
See all IP10 proteins and peptides -
Biological activity
The biological activity of recombinant swine IP10 was determined in a chemotaxis assay using a Boyden chamber. Swine PBMCs were activated with PHA for 3 days followed by treatment with IL-2. Bioactivity is typically detected at 10 ng/mL.
-
Purity
> 95 % SDS-PAGE.
ab210921 is purified by ion-exchange chromatography. -
Expression system
Yeast -
Accession
-
Protein length
Full length protein -
Animal free
No -
Nature
Recombinant -
-
Species
Pig -
Sequence
PLSRTVRCTCIKISDRPVNPRSLEKLEMIPASQSCPHVEIIATMKKNGEK RCLNPESKTIKNLLKAISKERSKRSPRTQREA -
Predicted molecular weight
9 kDa -
Amino acids
23 to 104 -
Additional sequence information
This product is for the mature full length protein. The signal peptide is not included.
-
Preparation and Storage
- Interferon gamma induced factor MOB1, mouse, homolog of
- Interferon gamma induced protein 10
- 10 kDa interferon gamma induced protein
