Call: +7 771 977 66 65, +7 705 421 2277
Sign in or Register
My basket

Astana Biomed Group, an authorized Abcam distributor in Central Asia

Abiomed homepage

  • Categories
    Signal Transduction
    Cancer
    Epigenetics and Nuclear Signaling
    Immunology
    Cell Biology
    Cardiovascular
    Neuroscience
    Tags & Cell Markers
    Kits/ Lysates/ Other
    Developmental Biology
    Microbiology
    Biochemicals
    Secondary antibodies
    Isotype/Loading Controls
    Antibody Arrays
  • About us
  • Partners
  • Contact
    Address

    Saryarka 32, 18, 010000, Astana city, Kazakhstan

    Telephone +7 771 977 66 65, +7 705 421 2277

    Email

    laboratory@ctlab.kz, orders@abiomed.kz

Back to category
Cancer Tumor immunology Cytokines Interleukins

Recombinant Pig IL-1 beta protein (ab107956)

Key features and details

  • Expression system: Yeast
  • Purity: > 95% SDS-PAGE
  • Suitable for: SDS-PAGE

You may also be interested in

Product image
Human IL-22 Matched Antibody Pair Kit (ab219535)
Product image
Anti-IL-13 receptor alpha 2 antibody [018] - BSA and Azide free (ab277143)
Product image
Human IL-1 R4 ELISA Kit (ST2) (ab100563)
Product image
Human Th1/Th2/Th17 Antibody Array - Membrane (34 targets) (ab169809)

Description

  • Product name

    Recombinant Pig IL-1 beta protein
    See all IL-1 beta proteins and peptides
  • Purity

    > 95 % SDS-PAGE.
    ab107956 is purified by Ion-exchange chromatography.
  • Expression system

    Yeast
  • Accession

    P26889
  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Pig
    • Sequence

      ANVQSMECKLQDKDHKSLVLAGPHMLKALHLLTGDLKREVVFCMSFVQGD DSNNKIPVTLGIKGKNLYLSCVMKDNTPTLQLEDIDPKRYPKRDMEKRFV FYKTEIKNRVEFESALYPNWYISTSQAEQKPVFLGNSKGRQDITDFTMEV LSP
    • Predicted molecular weight

      18 kDa
    • Amino acids

      115 to 267

Preparation and Storage

  • Alternative names

    • Catabolin
    • H1
    • IFN beta inducing factor
    • IL 1
    • IL 1 beta
    • IL-1 beta
    • IL1
    • IL1 BETA
    • IL1B
    • IL1B_HUMAN
    • IL1F2
    • Interleukin 1 beta
    • Interleukin 1 beta precursor
    • interleukin 1, beta
    • Interleukin-1 beta
    • OAF
    • Osteoclast activating factor
    • OTTHUMP00000162031
    • Preinterleukin 1 beta
    • Preinterleukin beta
    • Pro interleukin 1 beta
    see all
  • Function

    Potent proinflammatory cytokine. Initially discovered as the major endogenous pyrogen, induces prostaglandin synthesis, neutrophil influx and activation, T-cell activation and cytokine production, B-cell activation and antibody production, and fibroblast proliferation and collagen production. Promotes Th17 differentiation of T-cells.
  • Tissue specificity

    Expressed in activated monocytes/macrophages (at protein level).
  • Sequence similarities

    Belongs to the IL-1 family.
  • Post-translational
    modifications

    Activation of the IL1B precursor involves a CASP1-catalyzed proteolytic cleavage. Processing and secretion are temporarily associated.
  • Cellular localization

    Cytoplasm, cytosol. Lysosome. Secreted, exosome. Cytoplasmic vesicle, autophagosome. Secreted. The precursor is cytosolic. In response to inflammasome-activating signals, such as ATP for NLRP3 inflammasome or bacterial flagellin for NLRC4 inflammasome, cleaved and secreted. IL1B lacks any known signal sequence and the pathway(s) of its secretion is(are) not yet fully understood (PubMed:24201029). On the basis of experimental results, several unconventional secretion mechanisms have been proposed. 1. Secretion via secretory lysosomes: a fraction of CASP1 and IL1B precursor may be incorporated, by a yet undefined mechanism, into secretory lysosomes that undergo Ca(2+)-dependent exocytosis with release of mature IL1B (PubMed:15192144). 2. Secretory autophagy: IL1B-containing autophagosomes may fuse with endosomes or multivesicular bodies (MVBs) and then merge with the plasma membrane releasing soluble IL1B or IL1B-containing exosomes (PubMed:24201029). However, autophagy impacts IL1B production at several levels and its role in secretion is still controversial. 3. Secretion via exosomes: ATP-activation of P2RX7 leads to the formation of MVBs containing exosomes with entrapped IL1B, CASP1 and other inflammasome components. These MVBs undergo exocytosis with the release of exosomes. The release of soluble IL1B occurs after the lysis of exosome membranes (By similarity). 4. Secretion by microvesicle shedding: activation of the ATP receptor P2RX7 may induce an immediate shedding of membrane-derived microvesicles containing IL1B and possibly inflammasome components. The cytokine is then released in the extracellular compartment after microvesicle lysis (PubMed:11728343). 5. Release by translocation through permeabilized plasma membrane. This may occur in cells undergoing pyroptosis due to sustained activation of the inflammasome (By similarity). These mechanisms may not be not mutually exclusive.
  • Target information above from: UniProt accession P01584 The UniProt Consortium
    The Universal Protein Resource (UniProt) in 2010
    Nucleic Acids Res. 38:D142-D148 (2010) .

    Information by UniProt

Images

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Alternative products to Recombinant Pig IL-1 beta protein (ab107956)

  •  
  • Product image

    Recombinant human IL-1 beta protein (Active) (ab155616)

    Applications: FuncS, SDS-PAGE

  •  
  • Recombinant rat IL-1 beta protein (ab9788)

    Applications: FuncS, SDS-PAGE

  •  
  • Product image

    Recombinant human IL-1 beta protein (ab157280)

    Applications: FuncS, SDS-PAGE

  •  
  • Recombinant rat IL-1 beta protein (Active) (ab200284)

    Applications: FuncS, HPLC, SDS-PAGE

  •  
  • Recombinant human IL-1 beta protein (Active) (ab9617)

    Applications: FuncS, HPLC, SDS-PAGE

  •  
  • Product image

    Recombinant mouse IL-1 beta protein (Active) (ab219437)

    Applications: FuncS, MS, SDS-PAGE

  •  
  • Recombinant mouse IL-1 beta protein (ab9723)

    Applications: FuncS, SDS-PAGE

Clear all

Recently viewed products

  •  
  • Product image

    Anti-Angiotensin Converting Enzyme 1 antibody [EPR2757] - BSA and Azide free (ab239864)

  •  
  • Product image

    ROS/Superoxide Detection Assay Kit (Cell-based) (ab139476)

  •  
  • Product image

    FITC Anti-c-Fos (phospho S32) antibody [cFosS32-BA9] (ab278658)

  •  
  • Rat monoclonal [23G3] Anti-Mouse IgE epsilon chain (PE) (ab99588)

  •  
  • Goat F(ab')2 Anti-Rabbit IgG Fc (Alkaline Phosphatase) (ab6024)

  •  
  • (-)-Bicuculline methiodide, GABA<sub>A</sub> antagonist (ab120108)

Get resources and offers direct to your inbox Sign up
© 2021 Astana Biomed Group LLP. All rights reserved.