Call: +7 771 977 66 65, +7 705 421 2277
Sign in or Register
My basket

Astana Biomed Group, an authorized Abcam distributor in Central Asia

Abiomed homepage

  • Categories
    Signal Transduction
    Cancer
    Epigenetics and Nuclear Signaling
    Immunology
    Cell Biology
    Cardiovascular
    Neuroscience
    Tags & Cell Markers
    Kits/ Lysates/ Other
    Developmental Biology
    Microbiology
    Biochemicals
    Secondary antibodies
    Isotype/Loading Controls
    Antibody Arrays
  • About us
  • Partners
  • Contact
    Address

    Saryarka 32, 18, 010000, Astana city, Kazakhstan

    Telephone +7 771 977 66 65, +7 705 421 2277

    Email

    laboratory@ctlab.kz, orders@abiomed.kz

Back to category
Signal Transduction Growth Factors/Hormones Hormones

Recombinant Mouse RELM Gamma protein (Animal Free) (Animal Free) (ab219127)

Recombinant Mouse RELM Gamma protein (Animal Free) (Animal Free) (ab219127)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)

Key features and details

  • Expression system: Escherichia coli
  • Purity: > 95% SDS-PAGE
  • Endotoxin level:
  • Suitable for: SDS-PAGE

You may also be interested in

Product image
Recombinant human Growth Hormone protein (Active) (ab268594)
Product image
Anti-HSD11B2 antibody (ab115696)
Anti-Exendin 4 antibody [20] (ab23407)
Product image
Anti-Inhibin alpha antibody [PO12/8] - BSA and Azide free (ab273486)

Description

  • Product name

    Recombinant Mouse RELM Gamma protein (Animal Free) (Animal Free)
    See all RELM Gamma proteins and peptides
  • Purity

    > 95 % SDS-PAGE.

  • Endotoxin level

  • Expression system

    Escherichia coli
  • Accession

    Q7TM98
  • Protein length

    Full length protein
  • Animal free

    Yes
  • Nature

    Recombinant
    • Species

      Mouse
    • Sequence

      MEGTLESIVEKKVKELLANRDDCPSTVTKTFSCTSITASGRLASCPSGMT VTGCACGYGCGSWDIRDGNTCHCQCSTMDWATARCCQLA
    • Predicted molecular weight

      19 kDa
    • Amino acids

      24 to 111
    • Additional sequence information

      This product is the mature full length protein from aa 24 to 111. The signal peptide is not included. Dimer.
  • Description

    Recombinant Mouse RELM Gamma protein (Animal Free)
  • Specifications

    Our Abpromise guarantee covers the use of ab219127 in the following tested applications.

    The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

    • Applications

      SDS-PAGE

    • Form

      Lyophilized
    • Concentration information loading...

    Preparation and Storage

    • Stability and Storage

      Shipped at 4°C. Store at -20°C long term. Avoid freeze / thaw cycle.

      Constituent: 0.16% Sodium phosphate

      Lyophilized from a sterile 0.2 micron filtered solution.

    • Reconstitution
      Centrifuge vial before opening. Suspend the product by gently pipetting sterile deionized water down the sides of the vial to a final concentration of 0.1 mg/ml. DO NOT VORTEX. Allow several minutes for complete reconstitution. For prolonged storage, dilute to working aliquots in a 0.1% BSA solution, store at -80°C and avoid repeat freeze thaws.

    General Info

    • Alternative names

      • Fizz3
      • Myeloid cysteine rich protein
      • Resistin like gamma
      • Resistin like molecule gamma
      • Retnlg
      • Xcp1
      see all
    • Relevance

      RELM gamma is a novel member of the resistin-like molecule/found in inflammatory zone (RELM/FIZZ) family in mice and rats. Micro-array and real-time RT-PCR experiments revealed a repression of RELM gamma mRNA in nasal respiratory epithelium of cigarette smoke-exposed versus untreated rats. The analysis of the physiological tissue-specific expression revealed highest expression in hematopoietic tissues, suggesting a cytokine-like role for RELM gamma. RELM-gamma-mRNA is detectable in bone marrow, spleen, and lung as well as in peripheral blood granulocytes. Promyelocytic HL60 cells transfected with a RELM gamma expression plasmid have an increased proliferation rate compared to mock-transfected cells and display an altered response to retinoic acid-induced granulocytic differentiation. Taken together, these data provide the first experimental evidence that RELM gamma is a secreted molecule with a restricted expression pattern that may play a role in promyelocytic differentiation.
    • Cellular localization

      Secreted

Images

  • SDS-PAGE - Recombinant Mouse RELM Gamma protein (Animal Free) (Animal Free) (ab219127)
    SDS-PAGE - Recombinant Mouse RELM Gamma protein (Animal Free) (Animal Free) (ab219127)

    1 µg ab219127 analyzed on a 4-20% Tris-Glycine gel, stained with Coomassie Blue.

    Lane 1: Non-reducing conditions.

    Lane 2: Reducing conditions.

    ab219127 is predicted to be a dimer with a total weight of 18.9 kDa, but the dimer runs larger (each monomer is predicted to be 9.4 kDa).

Protocols

To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.

Click here to view the general protocols

Datasheets and documents

    • Datasheet
  • References (0)

    Publishing research using ab219127? Please let us know so that we can cite the reference in this datasheet.

    ab219127 has not yet been referenced specifically in any publications.

    Preparation and Storage

    • Fizz3
    • Myeloid cysteine rich protein
    • Resistin like gamma

    Images

    • SDS-PAGE - Recombinant Mouse RELM Gamma protein (Animal Free) (Animal Free) (ab219127)
      SDS-PAGE - Recombinant Mouse RELM Gamma protein (Animal Free) (Animal Free) (ab219127)

      1 µg ab219127 analyzed on a 4-20% Tris-Glycine gel, stained with Coomassie Blue.

      Lane 1: Non-reducing conditions.

      Lane 2: Reducing conditions.

      ab219127 is predicted to be a dimer with a total weight of 18.9 kDa, but the dimer runs larger (each monomer is predicted to be 9.4 kDa).

    Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
    For licensing inquiries, please contact partnerships@abcam.com

    Alternative products to Recombinant Mouse RELM Gamma protein (Animal Free) (Animal Free) (ab219127)

    •  
    • Product image

      Recombinant Mouse RELM Gamma protein (ab219132)

      Applications: SDS-PAGE

    Get resources and offers direct to your inbox Sign up
    © 2021 Astana Biomed Group LLP. All rights reserved.