Recombinant Mouse RELM Gamma protein (Animal Free) (Animal Free) (ab219127)
Key features and details
- Expression system: Escherichia coli
- Purity: > 95% SDS-PAGE
- Endotoxin level:
- Suitable for: SDS-PAGE
-
Product name
Recombinant Mouse RELM Gamma protein (Animal Free) (Animal Free)
See all RELM Gamma proteins and peptides -
Purity
> 95 % SDS-PAGE. -
Endotoxin level
Expression system
Escherichia coliAccession
Protein length
Full length proteinAnimal free
YesNature
Recombinant-
Species
Mouse -
Sequence
MEGTLESIVEKKVKELLANRDDCPSTVTKTFSCTSITASGRLASCPSGMT VTGCACGYGCGSWDIRDGNTCHCQCSTMDWATARCCQLA -
Predicted molecular weight
19 kDa -
Amino acids
24 to 111 -
Additional sequence information
This product is the mature full length protein from aa 24 to 111. The signal peptide is not included. Dimer.
Description
Recombinant Mouse RELM Gamma protein (Animal Free)Specifications
Our Abpromise guarantee covers the use of ab219127 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
SDS-PAGE
-
Form
Lyophilized -
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped at 4°C. Store at -20°C long term. Avoid freeze / thaw cycle.
Constituent: 0.16% Sodium phosphate
Lyophilized from a sterile 0.2 micron filtered solution. -
ReconstitutionCentrifuge vial before opening. Suspend the product by gently pipetting sterile deionized water down the sides of the vial to a final concentration of 0.1 mg/ml. DO NOT VORTEX. Allow several minutes for complete reconstitution. For prolonged storage, dilute to working aliquots in a 0.1% BSA solution, store at -80°C and avoid repeat freeze thaws.
General Info
-
Alternative names
- Fizz3
- Myeloid cysteine rich protein
- Resistin like gamma
see all -
Relevance
RELM gamma is a novel member of the resistin-like molecule/found in inflammatory zone (RELM/FIZZ) family in mice and rats. Micro-array and real-time RT-PCR experiments revealed a repression of RELM gamma mRNA in nasal respiratory epithelium of cigarette smoke-exposed versus untreated rats. The analysis of the physiological tissue-specific expression revealed highest expression in hematopoietic tissues, suggesting a cytokine-like role for RELM gamma. RELM-gamma-mRNA is detectable in bone marrow, spleen, and lung as well as in peripheral blood granulocytes. Promyelocytic HL60 cells transfected with a RELM gamma expression plasmid have an increased proliferation rate compared to mock-transfected cells and display an altered response to retinoic acid-induced granulocytic differentiation. Taken together, these data provide the first experimental evidence that RELM gamma is a secreted molecule with a restricted expression pattern that may play a role in promyelocytic differentiation. -
Cellular localization
Secreted
Images
-
SDS-PAGE - Recombinant Mouse RELM Gamma protein (Animal Free) (Animal Free) (ab219127)
1 µg ab219127 analyzed on a 4-20% Tris-Glycine gel, stained with Coomassie Blue.
Lane 1: Non-reducing conditions.
Lane 2: Reducing conditions.
ab219127 is predicted to be a dimer with a total weight of 18.9 kDa, but the dimer runs larger (each monomer is predicted to be 9.4 kDa).
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
References (0)
ab219127 has not yet been referenced specifically in any publications.
Preparation and Storage
- Fizz3
- Myeloid cysteine rich protein
- Resistin like gamma
Images
-
SDS-PAGE - Recombinant Mouse RELM Gamma protein (Animal Free) (Animal Free) (ab219127)
1 µg ab219127 analyzed on a 4-20% Tris-Glycine gel, stained with Coomassie Blue.
Lane 1: Non-reducing conditions.
Lane 2: Reducing conditions.
ab219127 is predicted to be a dimer with a total weight of 18.9 kDa, but the dimer runs larger (each monomer is predicted to be 9.4 kDa).
