Recombinant mouse IL-17AF protein (ab109674)
Key features and details
- Expression system: Escherichia coli
- Purity: > 98% SDS-PAGE
- Endotoxin level:
- Active: Yes
- Suitable for: SDS-PAGE, HPLC, Functional Studies
-
Product name
Recombinant mouse IL-17AF protein -
Biological activity
The activity is determined by the dose-dependent induction of IL-6 production in cultured mouse NIH 3T3 fibroblasts, is typically 75-325 ng/mL.
-
Purity
> 98 % SDS-PAGE.
Purity Greater than 98% determined by reducing and non-reducing SDS-PAGE. -
Endotoxin level
Expression system
Escherichia coliProtein length
Full length proteinAnimal free
NoNature
Recombinant-
Species
Mouse -
Sequence
IL-17A subunit: MAAIIPQSSACPNTEAKDFLQNVKVNLKVFNSLGAKVSSRRPSDYLNRST SPWTLHRNEDPDRYPSVIWEAQCRHQRCVNAEGKLDHHMNSVLIQQEILV LKREPESCPFTFRVEKMLVGVGCTCVASIVRQAA
IL-17F subunit: MRKNPKAGVPALQKAGNCPPLEDNTVRVDIRIFNQNQGISVPREFQNRSS SPWDYNITRDPHRFPSEIAEAQCRHSGCINAQGQEDSTMNSVAIQQEILV LRREP -
Predicted molecular weight
31 kDa -
Additional sequence information
ab109674 is a disulfide-linked heterodimer. It contains one IL-17A subunit and one IL-17F subunit. It contains 271 amino acids and has a molecular weight of 30.7 kDa.
Associated products
-
Related Products
Specifications
Our Abpromise guarantee covers the use of ab109674 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
SDS-PAGE
HPLC
Functional Studies
-
Form
Lyophilized -
Additional notes
Recombinant mouse IL-17AF is a non-glycosylated, disulfide-linked heterodimer. It contains one IL-17A subunit and one IL-17F subunit, with a total of 271 amino acids and an molecular weight of 30.7 kDa.
-
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped at 4°C. Store at -80°C. Avoid freeze / thaw cycle. For long term storage it is recommended to add a carrier protein on reconstitution (0.1% HSA or BSA).
This product is an active protein and may elicit a biological response in vivo, handle with caution.
-
ReconstitutionIt is recommended to reconstitute ab109674 with sterile water to a concentration of 0.1 mg/ml, which can be further diluted into other aqueous solutions. It is recommended that a carrier protein (0.1% HSA or BSA) is added for long term storage.
General Info
-
Relevance
Interleukin-17AF (IL-17AF) is a member of the IL-17 family of proteins produced by a subset of T cells, called Th17, following stimulation with IL-23. Since IL-17AF is thought to signal through the IL-17R receptor, its biological function is similar to that of IL-17A in that it induces the production of a variety of chemokines, in addition to airway neutrophilia. In regard to these functions, IL-17AF has less activity than the IL-17A homodimer but, greater activity than the IL-17F homodimer. Human and rat IL-17AF both show activity on mouse cells.
Images
-
Western blot - Recombinant mouse IL-17AF protein (ab109674)ab109674 used in Western Blot. Figure: 1 ug in each lane (-) non-reducing conditions and (+) reducing conditions in a 4-20% Tris-Glycine gel stained with Coomassie Blue. Mouse IL-17AF is a heterodimer with a predicted total MW of 30.7 kDa.
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
References (0)
ab109674 has not yet been referenced specifically in any publications.
Preparation and Storage
-
Stability and Storage
Shipped at 4°C. Store at -80°C. Avoid freeze / thaw cycle. For long term storage it is recommended to add a carrier protein on reconstitution (0.1% HSA or BSA).
This product is an active protein and may elicit a biological response in vivo, handle with caution.
-
ReconstitutionIt is recommended to reconstitute ab109674 with sterile water to a concentration of 0.1 mg/ml, which can be further diluted into other aqueous solutions. It is recommended that a carrier protein (0.1% HSA or BSA) is added for long term storage.
Images
-
Western blot - Recombinant mouse IL-17AF protein (ab109674)ab109674 used in Western Blot. Figure: 1 ug in each lane (-) non-reducing conditions and (+) reducing conditions in a 4-20% Tris-Glycine gel stained with Coomassie Blue. Mouse IL-17AF is a heterodimer with a predicted total MW of 30.7 kDa.