Recombinant mouse IL-12B protein (Active) (ab264026)
Key features and details
- Expression system: HEK 293 cells
- Active: Yes
- Suitable for: SDS-PAGE, HPLC, Functional Studies
-
Product name
Recombinant mouse IL-12B protein (Active)
See all IL-12B proteins and peptides -
Biological activity
Determined by its ability to inhibit the proliferative effect of 2 ng/ml mIL-12 p70 in T cell-enriched PBMCs.
-
Expression system
HEK 293 cells -
Accession
-
Protein length
Full length protein -
Animal free
No -
Nature
Recombinant -
-
Species
Mouse -
Sequence
MWELEKDVYVVEVDWTPDAPGETVNLTCDTPEEDDITWTSDQRHGVIGSG KTLTITVKEFLDAGQYTCHKGGETLSHSHLLLHKKENGIWSTEILKNFKN KTFLKCEAPNYSGRFTCSWLVQRNMDLKFNIKSSSSSPDSRAVTCGMASL SAEKVTLDQRDYEKYSVSCQEDVTCPTAEETLPIELALEARQQNKYENYS TSFFIRDIIKPDPPKNLQMKPLKNSQVEVSWEYPDSWSTPHSYFSLKFFV RIQRKKEKMKETEEGCNQKGAFLVEKTSTEVQCKGGNVCVQAQDRYYNSS CSKWACVPCRVRS -
Predicted molecular weight
36 kDa -
Molecular weight information
Predicted MW refers to monomer -
Amino acids
23 to 335 -
Additional sequence information
Full-length mature chain without signal peptide. Disulfide linked homodimer of two p40 chains of IL-12 consisting of 626 amino acid residues and less than 5% of the IL-12 p40 monomer. 36kDa monomer.
-
Preparation and Storage
-
Alternative names
- CLMF
- CLMF p40
- CLMF2
see all -
Function
Cytokine that can act as a growth factor for activated T and NK cells, enhance the lytic activity of NK/lymphokine-activated killer cells, and stimulate the production of IFN-gamma by resting PBMC.
Associates with IL23A to form the IL-23 interleukin, a heterodimeric cytokine which functions in innate and adaptive immunity. IL-23 may constitute with IL-17 an acute response to infection in peripheral tissues. IL-23 binds to a heterodimeric receptor complex composed of IL12RB1 and IL23R, activates the Jak-Stat signaling cascade, stimulates memory rather than naive T-cells and promotes production of proinflammatory cytokines. IL-23 induces autoimmune inflammation and thus may be responsible for autoimmune inflammatory diseases and may be important for tumorigenesis. -
Involvement in disease
Mendelian susceptibility to mycobacterial disease
Psoriasis 11 -
Sequence similarities
Belongs to the type I cytokine receptor family. Type 3 subfamily.
Contains 1 fibronectin type-III domain.
Contains 1 Ig-like C2-type (immunoglobulin-like) domain. -
Post-translational
modificationsKnown to be C-mannosylated in the recombinant protein; it is not yet known for sure if the wild-type protein is also modified. -
Cellular localization
Secreted. - Information by UniProt