Call: +7 771 977 66 65, +7 705 421 2277
Sign in or Register
My basket

Astana Biomed Group, an authorized Abcam distributor in Central Asia

Abiomed homepage

  • Categories
    Signal Transduction
    Cancer
    Epigenetics and Nuclear Signaling
    Immunology
    Cell Biology
    Cardiovascular
    Neuroscience
    Tags & Cell Markers
    Kits/ Lysates/ Other
    Developmental Biology
    Microbiology
    Biochemicals
    Secondary antibodies
    Isotype/Loading Controls
    Antibody Arrays
  • About us
  • Partners
  • Contact
    Address

    Saryarka 32, 18, 010000, Astana city, Kazakhstan

    Telephone +7 771 977 66 65, +7 705 421 2277

    Email

    laboratory@ctlab.kz, orders@abiomed.kz

Back to category
Immunology Adaptive Immunity T Cells Cytotoxic Cells

Recombinant mouse CTLA4 protein (Active) (Biotin) (ab271481)

Recombinant mouse CTLA4 protein (Active) (Biotin) (ab271481)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)

Key features and details

  • Expression system: HEK 293 cells
  • Purity: >= 90% SDS-PAGE
  • Active: Yes
  • Tags: Avi tag C-Terminus, Fc tag C-Terminus
  • Suitable for: Functional Studies, SDS-PAGE

You may also be interested in

Product image
Anti-SHIP-1 antibody (ab41836)
FITC Anti-Perforin antibody [B-D48], prediluted (ab86318)
Product image
Anti-CD226 antibody [EPR20710] - BSA and Azide free (ab251537)
PE Anti-CD8 alpha antibody [EP72] (ab25436)

Description

  • Product name

    Recombinant mouse CTLA4 protein (Active) (Biotin)
    See all CTLA4 proteins and peptides
  • Biological activity

    Recombinant Mouse CTLA4 protein (Active) (Biotin): B7-1 TR-FRET IC50 = 1.8 nm.

  • Purity

    >= 90 % SDS-PAGE.

  • Expression system

    HEK 293 cells
  • Accession

    P09793
  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Mouse
    • Sequence

      EAIQVTQPSVVLASSHGVASFPCEYSPSHNTDEVRVTVLRQTNDQMTEVC ATTFTEKNTVGFLDYPFCSGTFNESRVNLTIQGLRAVDTGLYLCKVELMY PPPYFVGMGNGTQIYVIDPEPCPDSD
    • Predicted molecular weight

      42 kDa
    • Amino acids

      36 to 161
    • Tags

      Avi tag C-Terminus , Fc tag C-Terminus
    • Additional sequence information

      Extracellular domain fused to the Fc portion of human IgG1.
  • Conjugation

    Biotin

Preparation and Storage

  • Alternative names

    • ALPS5
    • CD
    • CD 152
    • CD152
    • CD152 antigen
    • CD152 isoform
    • Celiac disease 3
    • CELIAC3
    • CTLA 4
    • CTLA-4
    • CTLA4
    • CTLA4_HUMAN
    • Cytotoxic T cell associated 4
    • Cytotoxic T lymphocyte antigen 4
    • Cytotoxic T lymphocyte associated 4
    • Cytotoxic T lymphocyte associated 4, soluble isoform, included
    • Cytotoxic T lymphocyte associated antigen 4
    • Cytotoxic T lymphocyte associated antigen 4 short spliced form
    • Cytotoxic T lymphocyte associated protein 4
    • Cytotoxic T lymphocyte associated serine esterase 4
    • Cytotoxic T lymphocyte protein 4
    • Cytotoxic T-lymphocyte protein 4
    • Cytotoxic T-lymphocyte-associated antigen 4
    • GRD4
    • GSE
    • ICOS
    • IDDM12
    • insulin-dependent diabetes mellitus 12
    • Ligand and transmembrane spliced cytotoxic T lymphocyte associated antigen 4
    • OTTHUMP00000216623
    see all
  • Function

    Inhibitory receptor acting as a major negative regulator of T-cell responses. The affinity of CTLA4 for its natural B7 family ligands, CD80 and CD86, is considerably stronger than the affinity of their cognate stimulatory coreceptor CD28.
  • Tissue specificity

    Widely expressed with highest levels in lymphoid tissues. Detected in activated T-cells where expression levels are 30- to 50-fold less than CD28, the stimulatory coreceptor, on the cell surface following activation.
  • Involvement in disease

    Genetic variation in CTLA4 influences susceptibility to systemic lupus erythematosus (SLE) [MIM:152700]. SLE is a chronic, inflammatory and often febrile multisystemic disorder of connective tissue. It affects principally the skin, joints, kidneys and serosal membranes. SLE is thought to represent a failure of the regulatory mechanisms of the autoimmune system.
    Note=Genetic variations in CTLA4 may influence susceptibility to Graves disease, an autoimmune disorder associated with overactivity of the thyroid gland and hyperthyroidism.
    Genetic variation in CTLA4 is the cause of susceptibility to diabetes mellitus insulin-dependent type 12 (IDDM12) [MIM:601388]. A multifactorial disorder of glucose homeostasis that is characterized by susceptibility to ketoacidosis in the absence of insulin therapy. Clinical fetaures are polydipsia, polyphagia and polyuria which result from hyperglycemia-induced osmotic diuresis and secondary thirst. These derangements result in long-term complications that affect the eyes, kidneys, nerves, and blood vessels.
    Genetic variation in CTLA4 is the cause of susceptibility to celiac disease type 3 (CELIAC3) [MIM:609755]. It is a multifactorial disorder of the small intestine that is influenced by both environmental and genetic factors. It is characterized by malabsorption resulting from inflammatory injury to the mucosa of the small intestine after the ingestion of wheat gluten or related rye and barley proteins. In its classic form, celiac disease is characterized in children by malabsorption and failure to thrive.
  • Sequence similarities

    Contains 1 Ig-like V-type (immunoglobulin-like) domain.
  • Post-translational
    modifications

    N-glycosylation is important for dimerization.
    Phosphorylation at Tyr-201 prevents binding to the AP-2 adapter complex, blocks endocytosis, and leads to retention of CTLA4 on the cell surface.
  • Cellular localization

    Cell membrane. Exists primarily an intracellular antigen whose surface expression is tightly regulated by restricted trafficking to the cell surface and rapid internalisation and.
  • Target information above from: UniProt accession P16410 The UniProt Consortium
    The Universal Protein Resource (UniProt) in 2010
    Nucleic Acids Res. 38:D142-D148 (2010) .

    Information by UniProt

Images

  • Functional Studies - Recombinant mouse CTLA4 protein (Active) (Biotin) (ab271481)
    Functional Studies - Recombinant mouse CTLA4 protein (Active) (Biotin) (ab271481)

    Recombinant Mouse CTLA4 protein (Active) (Biotin): B7-1 TR-FRET IC50 = 1.8 nm.

  • SDS-PAGE - Recombinant mouse CTLA4 protein (Active) (Biotin) (ab271481)
    SDS-PAGE - Recombinant mouse CTLA4 protein (Active) (Biotin) (ab271481)

    SDS-PAGE analysis of 2 µg ab271481.

    This protein runs at a higher MW by SDS-PAGE due to glycosylation.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Clear all

Recently viewed products

  •  
  • Product image

    Anti-DMT1 antibody (ab140977)

  •  
  • Product image

    Anti-RPS2 antibody (ab264336)

  •  
  • Product image

    Human CXCL9 ELISA Kit (ab100595)

  •  
  • Product image

    Anti-Spindly antibody (ab187997)

  •  
  • Product image

    Anti-IL-10 antibody (ab187251)

  •  
  • Product image

    Anti-C1QL1 antibody (ab68528)

Get resources and offers direct to your inbox Sign up
© 2021 Astana Biomed Group LLP. All rights reserved.