Recombinant mouse CD200 / OX2 protein (ab214615)
Key features and details
- Expression system: CHO cells
- Purity: >= 98% SDS-PAGE
- Endotoxin level:
- Active: Yes
- Suitable for: SDS-PAGE, Functional Studies
-
Product name
Recombinant mouse CD200 / OX2 protein
See all CD200 / OX2 proteins and peptides -
Biological activity
Shows the biological function of the CD200 / OX2 moiety and exerts a prolonged circulating halflife caused by the modified Fc domain.
-
Purity
>= 98 % SDS-PAGE. -
Endotoxin level
Expression system
CHO cellsAccession
Protein length
Protein fragmentAnimal free
NoNature
Recombinant-
Species
Mouse -
Sequence
QVEVVTQDERKALHTTASLRCSLKTSQEPLIVTWQKKKAVSPENMVTYSK THGVVIQPAYKDRINVTELGLWNSSITFWNTTLEDEGCYMCLFNTFGSQK VSGTACLTLYVQPIVHLHYNYFEDHLNITCSATARPAPAISWKGTGTGIE NSTESHFHSNGTTSVTSILRVKDPKTQVGKEVICQVLYLGNVIDYKQSLD KGFWFS -
Amino acids
31 to 236 -
Additional sequence information
The extracellular domain of mouse CD200 / OX2 (aa 31-236) is fused to the N-terminus of the Fc region of a mutant mouse IgG2a.
Specifications
Our Abpromise guarantee covers the use of ab214615 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
SDS-PAGE
Functional Studies
-
Form
Lyophilized -
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C. Avoid freeze / thaw cycle. Stable for 12 months at -20°C.
Constituent: 99% PBS
Lyophilized from 0.2 µm filtered solution.This product is an active protein and may elicit a biological response in vivo, handle with caution.
-
ReconstitutionReconstitute at 100 µg/mL in sterile PBS. Working aliquots are stable for up to 3 months when stored at -20°C.
General Info
-
Alternative names
- Antigen identified by monoclonal antibody MRC OX 2
- CD200
- CD200 antigen
see all -
Function
Costimulates T-cell proliferation. May regulate myeloid cell activity in a variety of tissues. -
Sequence similarities
Contains 1 Ig-like C2-type (immunoglobulin-like) domain.
Contains 1 Ig-like V-type (immunoglobulin-like) domain. -
Cellular localization
Cell membrane. - Information by UniProt
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
References (0)
ab214615 has not yet been referenced specifically in any publications.
Preparation and Storage
- Antigen identified by monoclonal antibody MRC OX 2
- CD200
- CD200 antigen