Recombinant mouse C10 protein (Active) (ab243257)
Key features and details
- Expression system: Escherichia coli
- Purity: > 97% SDS-PAGE
- Endotoxin level:
- Active: Yes
- Suitable for: SDS-PAGE, Functional Studies, HPLC
-
Product name
Recombinant mouse C10 protein (Active)
See all C10 proteins and peptides -
Biological activity
Fully biologically active when compared to standard. The biologically active determined by a chemotaxis bioassay using human CCR1 transfected murine BaF3 cells is in a concentration range of 10-100 ng/ml.
-
Purity
> 97 % SDS-PAGE.
> 97 % by HPLC -
Endotoxin level
Expression system
Escherichia coliAccession
Protein length
Full length proteinAnimal free
NoNature
Recombinant-
Species
Mouse -
Sequence
GLIQEIEKEDRRYNPPIIHQGFQDTSSDCCFSYATQIPCKRFIYYFPTSG GCIKPGIIFISRRGTQVCADPSDRRVQRCLSTLKQGPRSGNKVIA -
Predicted molecular weight
11 kDa -
Amino acids
22 to 116 -
Additional sequence information
Full-length mature chain lacking the signal peptide.
Associated products
-
Related Products
Specifications
Our Abpromise guarantee covers the use of ab243257 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
SDS-PAGE
Functional Studies
HPLC
-
Form
Lyophilized -
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle.
Constituent: PBS
0.2 µm filteredThis product is an active protein and may elicit a biological response in vivo, handle with caution.
-
ReconstitutionBriefly centrifuge prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at -20 °C or below. Further dilutions should be made in appropriate buffered solutions.
General Info
-
Alternative names
- C10
- CCL 6
- chemokine (C-C motif) ligand 6
see all -
Relevance
CCL6 (C10) is a small cytokine belonging to the CC chemokine family that has only been identified in rodents. It is a potent chemoattractant of macrophages, but it can also attract B cells, CD4+ lymphocytes and eosinophils. In mice, CCL6 is expressed in cells from neutrophil and macrophage lineages, and can be induced under conditions suitable for myeloid cell differentiation. CCL6 (C10) was originally identified as a transcript that is induced in bone marrow cells upon stimulation of GMCSF. The cell surface receptor for CCL6 is believed to be the chemokine receptor CCR1. -
Cellular localization
Secreted
Images
-
SDS-PAGE - Recombinant mouse C10 protein (Active) (ab243257)SDS Page analysis of ab243257
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
References (0)
ab243257 has not yet been referenced specifically in any publications.
Preparation and Storage
-
Stability and Storage
Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle.
Constituent: PBS
0.2 µm filteredThis product is an active protein and may elicit a biological response in vivo, handle with caution.
-
ReconstitutionBriefly centrifuge prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at -20 °C or below. Further dilutions should be made in appropriate buffered solutions.
Images
-
SDS-PAGE - Recombinant mouse C10 protein (Active) (ab243257)SDS Page analysis of ab243257
