Call: +7 771 977 66 65, +7 705 421 2277
Sign in or Register
My basket

Astana Biomed Group, an authorized Abcam distributor in Central Asia

Abiomed homepage

  • Categories
    Signal Transduction
    Cancer
    Epigenetics and Nuclear Signaling
    Immunology
    Cell Biology
    Cardiovascular
    Neuroscience
    Tags & Cell Markers
    Kits/ Lysates/ Other
    Developmental Biology
    Microbiology
    Biochemicals
    Secondary antibodies
    Isotype/Loading Controls
    Antibody Arrays
  • About us
  • Partners
  • Contact
    Address

    Saryarka 32, 18, 010000, Astana city, Kazakhstan

    Telephone +7 771 977 66 65, +7 705 421 2277

    Email

    laboratory@ctlab.kz, orders@abiomed.kz

Back to category
Immunology Innate Immunity Chemokines Beta Chemokines (CC)

Recombinant mouse C10 protein (Active) (ab243257)

Recombinant mouse C10 protein (Active) (ab243257)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)

Key features and details

  • Expression system: Escherichia coli
  • Purity: > 97% SDS-PAGE
  • Endotoxin level:
  • Active: Yes
  • Suitable for: SDS-PAGE, Functional Studies, HPLC

You may also be interested in

Product image
Human MDC Matched Antibody Pair Kit (ab222269)
Recombinant human TARC/CCL17 protein (ab9817)
Product image
Human TECK Antibody Pair - BSA and Azide free (ab256624)
Product image
Human Exodus 2 ELISA Kit (CCL21) (ab193759)

Description

  • Product name

    Recombinant mouse C10 protein (Active)
    See all C10 proteins and peptides
  • Biological activity

    Fully biologically active when compared to standard. The biologically active determined by a chemotaxis bioassay using human CCR1 transfected murine BaF3 cells is in a concentration range of 10-100 ng/ml.

  • Purity

    > 97 % SDS-PAGE.
    > 97 % by HPLC
  • Endotoxin level

  • Expression system

    Escherichia coli
  • Accession

    P27784
  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Mouse
    • Sequence

      GLIQEIEKEDRRYNPPIIHQGFQDTSSDCCFSYATQIPCKRFIYYFPTSG GCIKPGIIFISRRGTQVCADPSDRRVQRCLSTLKQGPRSGNKVIA
    • Predicted molecular weight

      11 kDa
    • Amino acids

      22 to 116
    • Additional sequence information

      Full-length mature chain lacking the signal peptide.
  • Associated products

    • Related Products

      • Biotin Anti-C10 antibody (ab14395)
      • Anti-C10 antibody - C-terminal (ab198183)

    Specifications

    Our Abpromise guarantee covers the use of ab243257 in the following tested applications.

    The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

    • Applications

      SDS-PAGE

      Functional Studies

      HPLC

    • Form

      Lyophilized
    • Concentration information loading...

    Preparation and Storage

    • Stability and Storage

      Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

      Constituent: PBS

      0.2 µm filtered

      This product is an active protein and may elicit a biological response in vivo, handle with caution.

    • Reconstitution
      Briefly centrifuge prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at -20 °C or below. Further dilutions should be made in appropriate buffered solutions.

    General Info

    • Alternative names

      • C10
      • CCL 6
      • chemokine (C-C motif) ligand 6
      • Chemokine C C motif Ligand 6
      • MRP1
      • SCYA6
      • Small Inducible Cytokine A6
      see all
    • Relevance

      CCL6 (C10) is a small cytokine belonging to the CC chemokine family that has only been identified in rodents. It is a potent chemoattractant of macrophages, but it can also attract B cells, CD4+ lymphocytes and eosinophils. In mice, CCL6 is expressed in cells from neutrophil and macrophage lineages, and can be induced under conditions suitable for myeloid cell differentiation. CCL6 (C10) was originally identified as a transcript that is induced in bone marrow cells upon stimulation of GMCSF. The cell surface receptor for CCL6 is believed to be the chemokine receptor CCR1.
    • Cellular localization

      Secreted

Images

  • SDS-PAGE - Recombinant mouse C10 protein (Active) (ab243257)
    SDS-PAGE - Recombinant mouse C10 protein (Active) (ab243257)
    SDS Page analysis of ab243257

Protocols

To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.

Click here to view the general protocols

Datasheets and documents

    • Datasheet
  • References (0)

    Publishing research using ab243257? Please let us know so that we can cite the reference in this datasheet.

    ab243257 has not yet been referenced specifically in any publications.

    Preparation and Storage

    • Stability and Storage

      Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

      Constituent: PBS

      0.2 µm filtered

      This product is an active protein and may elicit a biological response in vivo, handle with caution.

    • Reconstitution
      Briefly centrifuge prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at -20 °C or below. Further dilutions should be made in appropriate buffered solutions.

    Images

    • SDS-PAGE - Recombinant mouse C10 protein (Active) (ab243257)
      SDS-PAGE - Recombinant mouse C10 protein (Active) (ab243257)
      SDS Page analysis of ab243257

    Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
    For licensing inquiries, please contact partnerships@abcam.com

    Alternative products to Recombinant mouse C10 protein (Active) (ab243257)

    •  
    • Product image

      Recombinant Mouse C10 protein (ab167708)

      Applications: SDS-PAGE

    •  
    • Recombinant rat C10 protein (Active) (ab201390)

      Applications: FuncS, HPLC, SDS-PAGE

    Clear all

    Recently viewed products

    •  
    • Product image

      Kinetic Apoptosis Kit (Microscopy) (ab129817)

    •  
    • Product image

      Recombinant human KAT5 / Tip60 protein (Active) (ab268696)

    •  
    • Product image

      Human IgG3 ELISA Kit (ab137981)

    •  
    • Product image

      Human IL-12 ELISA Kit (ab46037)

    •  
    • Product image

      Human KIT (c-Kit) knockout HeLa cell line (ab264768)

    •  
    • Recombinant human Fetuin A protein (ab123466)

    Get resources and offers direct to your inbox Sign up
    © 2021 Astana Biomed Group LLP. All rights reserved.