Recombinant mouse C10 protein (ab9898)
Key features and details
- Expression system: Escherichia coli
- Endotoxin level:
- Active: Yes
- Suitable for: Functional Studies, SDS-PAGE, WB
-
Product name
Recombinant mouse C10 protein
See all C10 proteins and peptides -
Endotoxin level
Expression system
Escherichia coliAccession
Protein length
Full length proteinAnimal free
NoNature
Recombinant-
Species
Mouse -
Sequence
GLIQEIEKEDRRYNPPIIHQGFQDTSSDCCFSYATQIPCKRFIYYFPTSG GCIKPGIIFISRRGTQVCADPSDRRVQRCLSTLKQGPRSGNKVIA -
Predicted molecular weight
11 kDa -
Amino acids
22 to 116
Associated products
Specifications
Our Abpromise guarantee covers the use of ab9898 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
Functional Studies
SDS-PAGE
Western blot
-
Form
Lyophilized -
Additional notes
The biological activity of this product was determined by its ability to chemoattract Balb/c mouse spleen MNCs using a concentration of 10-100ng/ml.
-
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.
This product is an active protein and may elicit a biological response in vivo, handle with caution.
-
ReconstitutionFor lot specific reconstitution information please contact our Scientific Support Team.
General Info
-
Alternative names
- C10
- CCL 6
- chemokine (C-C motif) ligand 6
see all -
Relevance
CCL6 (C10) is a small cytokine belonging to the CC chemokine family that has only been identified in rodents. It is a potent chemoattractant of macrophages, but it can also attract B cells, CD4+ lymphocytes and eosinophils. In mice, CCL6 is expressed in cells from neutrophil and macrophage lineages, and can be induced under conditions suitable for myeloid cell differentiation. CCL6 (C10) was originally identified as a transcript that is induced in bone marrow cells upon stimulation of GMCSF. The cell surface receptor for CCL6 is believed to be the chemokine receptor CCR1. -
Cellular localization
Secreted
Images
-
Western blot - Recombinant mouse C10 protein (ab9898)All lanes : Anti-C10 antibody (ab9897) at 0.2 µg/ml
Lane 1 :Recombinant mouse C10 protein (ab9898) at 0.1 µg
Lane 2 :Recombinant mouse C10 protein (ab9898) at 0.01 µg
Secondary
All lanes : Goat Anti-Rabbit IgG H&L (HRP) preadsorbed (ab97080) at 1/5000 dilution
Developed using the ECL technique.
Performed under reducing conditions.
Exposure time: 1 minute
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
References (0)
ab9898 has not yet been referenced specifically in any publications.
Preparation and Storage
-
Alternative names
- C10
- CCL 6
- chemokine (C-C motif) ligand 6
see all -
Relevance
CCL6 (C10) is a small cytokine belonging to the CC chemokine family that has only been identified in rodents. It is a potent chemoattractant of macrophages, but it can also attract B cells, CD4+ lymphocytes and eosinophils. In mice, CCL6 is expressed in cells from neutrophil and macrophage lineages, and can be induced under conditions suitable for myeloid cell differentiation. CCL6 (C10) was originally identified as a transcript that is induced in bone marrow cells upon stimulation of GMCSF. The cell surface receptor for CCL6 is believed to be the chemokine receptor CCR1. -
Cellular localization
Secreted
Images
-
Western blot - Recombinant mouse C10 protein (ab9898)All lanes : Anti-C10 antibody (ab9897) at 0.2 µg/ml
Lane 1 :Recombinant mouse C10 protein (ab9898) at 0.1 µg
Lane 2 :Recombinant mouse C10 protein (ab9898) at 0.01 µg
Secondary
All lanes : Goat Anti-Rabbit IgG H&L (HRP) preadsorbed (ab97080) at 1/5000 dilution
Developed using the ECL technique.
Performed under reducing conditions.
Exposure time: 1 minute