Recombinant human XCL2 protein (ab229847)
Key features and details
- Expression system: Escherichia coli
- Purity: > 98% SDS-PAGE
- Active: Yes
- Suitable for: MS, HPLC, SDS-PAGE
-
Product name
Recombinant human XCL2 protein -
Biological activity
Activity verified by intracellular calcium flux using HEK 293 cells.
-
Purity
> 98 % SDS-PAGE.
>98% by SDS-PAGE, HPLC, MALDI-MS and NMR analysis. Activity verified by intracellular calcium flux using HEK 293 cells. -
Expression system
Escherichia coli -
Accession
-
Protein length
Full length protein -
Animal free
No -
Nature
Recombinant -
-
Species
Human -
Sequence
VGSEVSHRRTCVSLTTQRLPVSRIKTYTITEGSLRAVIFITKRGLKVCAD PQATWVRDVVRSMDRKSNTRNNMIQTKPTGTQQSTNTAVTLTG -
Predicted molecular weight
10 kDa -
Amino acids
22 to 114 -
Additional sequence information
This protein is expressed in E. coli then processed, refolded and purified to yield the native, secreted form of the mature chemokine. Mature chain lacling the signal peptide.
-
Preparation and Storage
-
Stability and Storage
Shipped at 4°C. Store at -20°C long term.
Salt-free
This product is an active protein and may elicit a biological response in vivo, handle with caution.
-
ReconstitutionAdd deionized water to desired volume, aliquot and freeze unused portion.