Recombinant human Wnt9b protein (Active) (ab245815)
Key features and details
- Expression system: CHO cells
- Purity: >= 95% SDS-PAGE
- Endotoxin level:
- Active: Yes
- Suitable for: HPLC, SDS-PAGE, Functional Studies
-
Product name
Recombinant human Wnt9b protein (Active)
See all Wnt9b proteins and peptides -
Biological activity
Determined by its ability to induce alkaline phosphatase production by CCL-226 cells.
-
Purity
>= 95 % SDS-PAGE.
At least 95% by HPLC analysis. -
Endotoxin level
Expression system
CHO cellsAccession
Protein length
Full length proteinAnimal free
NoNature
Recombinant-
Species
Human -
Sequence
SYFGLTGREVLTPFPGLGTAAAPAQGGAHLKQCDLLKLSRRQKQLCRREP GLAETLRDAAHLGLLECQFQFRHERWNCSLEGRMGLLKRGFKETAFLYAV SSAALTHTLARACSAGRMERCTCDDSPGLESRQAWQWGVCGDNLKYSTKF LSNFLGSKRGNKDLRARADAHNTHVGIKAVKSGLRTTCKCHGVSGSCAVR TCWKQLSPFRETGQVLKLRYDSAVKVSSATNEALGRLELWAPARQGSLTK GLAPRSGDLVYMEDSPSFCRPSKYSPGTAGRVCSREASCSSLCCGRGYDT QSRLVAFSCHCQVQWCCYVECQQCVQEELVYTCKH -
Predicted molecular weight
37 kDa -
Amino acids
23 to 357 -
Additional sequence information
Full-length mature chain lacking the signal peptide.
Specifications
Our Abpromise guarantee covers the use of ab245815 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
HPLC
SDS-PAGE
Functional Studies
-
Form
Lyophilized -
Additional notes
Due to glycosylation, ab245815 migrates at an apparent molecular weight of approximately 49-54 kDa by SDS-PAGE analysis under non-reducing conditions.
-
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.
Constituents: 0.12% Tris, 0.56% Potassium chloride, 1.45% Sodium chloride, 0.375% CHAPS
This product is an active protein and may elicit a biological response in vivo, handle with caution.
-
ReconstitutionCentrifuge vial prior to opening. Reconstitute in water to 0.1-0.5 mg/ml. Do not vortex. Store at 4°C for 1 week, or prepare for extended storage. Follow reconstitution with further dilution in a buffer containing a carrier protein (example 0.1% BSA). Store working aliquots at -20°C to -80°C. Avoid repeated freeze-thaw cycles.
General Info
-
Alternative names
- MGC124412
- Protein Wnt 9b precursor
- Protein Wnt-14b
see all -
Relevance
Wnt9b is a member of the WNT family and is a ligand for members of the frizzled family of seven transmembrane receptors. The WNT gene family consists of structurally related genes that encode secreted signaling proteins. Wnt9b is expressed in the inductive epithelia and is essential for the development of mesonephric and metanephric tubules and caudal extension of the Müllerian duct. Wnt9b plays a central role in the regulation of mesenchymal to epithelial transitions underlying organogenesis of the mammalian urogenital system. The gene is clustered with WNT3, another family member, in the chromosome 17q21 region. -
Cellular localization
Secreted: extracellular space: extracellular matrix.
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
References (0)
ab245815 has not yet been referenced specifically in any publications.
Preparation and Storage
- MGC124412
- Protein Wnt 9b precursor
- Protein Wnt-14b