Recombinant human UCHL3 protein (ab103502)
Key features and details
- Expression system: Escherichia coli
- Purity: > 95% SDS-PAGE
- Active: Yes
- Tags: His tag N-Terminus
- Suitable for: Functional Studies, SDS-PAGE
-
Product name
Recombinant human UCHL3 protein
See all UCHL3 proteins and peptides -
Biological activity
Specific activity: >3,000 pmole/min/ug. Measured by the hydrolysis of Ubiquitin-AMC at pH 8.0, at 37°C.
Activity Assay:- Prepare a 100ul of recombinant UCH-L3 protein with various concentrations (0.48ng, 0.9ng) in assay buffer and equilibrate to 37°C for 10 minutes. (Assay buffer: 50mM Tris-HCl, 0.5 mM EDTA, 1 mM DTT, 0.1 mg/ml Ovalbumin, pH 8.0.)
- Add 50ul of 1uM Ubiquitin-AMC.
- Read at excitation wavelengths 355nm and emission 460nm for 5 minutes.
- Ubiquitin-AMC
- 96 Well Polystyrene Microplate, black
- Fluorescent plate reader (PerkinElmer, VICTOR X3)
-
Purity
> 95 % SDS-PAGE.
ab103502 purified by using anion-exchange chromatography (DEAE sepharose resin) and gel-filtration chromatography (Sephacryl S-200) with 20mM Tris pH 7.5, 2mM EDTA. -
Expression system
Escherichia coli -
Accession
-
Protein length
Full length protein -
Animal free
No -
Nature
Recombinant -
-
Species
Human -
Sequence
MGSSHHHHHHSSGLVPRGSHMEGQRWLPLEANPEVTNQFLKQLGLHPNWQ FVDVYGMDPELLSMVPRPVCAVLLLFPITEKYEVFRTEEEEKIKSQGQDV TSSVYFMKQTISNACGTIGLIHAIANNKDKMHFESGSTLKKFLEESVSMS PEERARYLENYDAIRVTHETSAHEGQTEAPSIDEKVDLHFIALVHVDGHL YELDGRKPFPINHGETSDETLLEDAIEVCKKFMERDPDELRFNAIALSAA -
Predicted molecular weight
28 kDa including tags -
Amino acids
1 to 230 -
Tags
His tag N-Terminus
-
Preparation and Storage
-
Stability and Storage
Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
pH: 8.00
Constituents: 0.0154% DTT, 0.316% Tris HCl, 10% GlycerolThis product is an active protein and may elicit a biological response in vivo, handle with caution.