Recombinant Human Transferrin Receptor protein (ab159687)
Key features and details
- Expression system: Wheat germ
- Tags: GST tag N-Terminus
- Suitable for: ELISA, WB
-
Product name
Recombinant Human Transferrin Receptor protein
See all Transferrin Receptor proteins and peptides -
Expression system
Wheat germ -
Protein length
Protein fragment -
Animal free
No -
Nature
Recombinant -
-
Species
Human -
Sequence
YGTIAVIVFFLIGFMIGYLGYCKGVEPKTECERLAGTESPVREEPGEDFP AARRLYWDDLKRKLSEKLDSTDFTGTIKLLNENSYVPREAGSQKDENLAL Y -
Amino acids
68 to 168 -
Tags
GST tag N-Terminus
-
Preparation and Storage
-
Alternative names
- CD 71
- CD71
- CD71 antigen
see all -
Function
Cellular uptake of iron occurs via receptor-mediated endocytosis of ligand-occupied transferrin receptor into specialized endosomes. Endosomal acidification leads to iron release. The apotransferrin-receptor complex is then recycled to the cell surface with a return to neutral pH and the concomitant loss of affinity of apotransferrin for its receptor. Transferrin receptor is necessary for development of erythrocytes and the nervous system (By similarity). A second ligand, the heditary hemochromatosis protein HFE, competes for binding with transferrin for an overlapping C-terminal binding site. Positively regulates T and B cell proliferation through iron uptake (PubMed:26642240).
(Microbial infection) Acts as a receptor for new-world arenaviruses: Guanarito, Junin and Machupo virus. -
Involvement in disease
Immunodeficiency 46 -
Sequence similarities
Belongs to the peptidase M28 family. M28B subfamily.
Contains 1 PA (protease associated) domain. -
Post-translational
modificationsN- and O-glycosylated, phosphorylated and palmitoylated. The serum form is only glycosylated.
Proteolytically cleaved on Arg-100 to produce the soluble serum form (sTfR).
Palmitoylated on both Cys-62 and Cys-67. Cys-62 seems to be the major site of palmitoylation. -
Cellular localization
Secreted and Cell membrane. Melanosome. Identified by mass spectrometry in melanosome fractions from stage I to stage IV. - Information by UniProt