Call: +7 771 977 66 65, +7 705 421 2277
Sign in or Register
My basket

Astana Biomed Group, an authorized Abcam distributor in Central Asia

Abiomed homepage

  • Categories
    Signal Transduction
    Cancer
    Epigenetics and Nuclear Signaling
    Immunology
    Cell Biology
    Cardiovascular
    Neuroscience
    Tags & Cell Markers
    Kits/ Lysates/ Other
    Developmental Biology
    Microbiology
    Biochemicals
    Secondary antibodies
    Isotype/Loading Controls
    Antibody Arrays
  • About us
  • Partners
  • Contact
    Address

    Saryarka 32, 18, 010000, Astana city, Kazakhstan

    Telephone +7 771 977 66 65, +7 705 421 2277

    Email

    laboratory@ctlab.kz, orders@abiomed.kz

Back to category
Signal Transduction Cytoskeleton / ECM Extracellular Matrix ECM Proteins Collagen

Recombinant Human TGFBI protein (ab86218)

Recombinant Human TGFBI protein (ab86218)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)

Key features and details

  • Expression system: Escherichia coli
  • Purity: > 95% SDS-PAGE
  • Suitable for: SDS-PAGE

You may also be interested in

Product image
Recombinant Human CTHRC1 protein (ab203710)
Product image
Anti-PCOLCE antibody (ab154261)
Product image
Anti-COL14A1 antibody (ab101464)
Product image
Anti-CTHRC1 antibody - BSA and Azide free (Detector) (ab274447)

Description

  • Product name

    Recombinant Human TGFBI protein
    See all TGFBI proteins and peptides
  • Purity

    > 95 % SDS-PAGE.
    purified by using conventional chromatography techniques.
  • Expression system

    Escherichia coli
  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MGTVMDVLKGDNRFSMLVAAIQSAGLTETLNREGVYTVFAPTNEAFRALP PRERSRLLGDAKELANILKYHIGDEILVSGGIGALVRLKSLQGDKLEVSL KNNVVSVNKEPVAEPDIMATNGVVHVITNVLQPPA
    • Amino acids

      502 to 636

Preparation and Storage

  • Alternative names

    • RGD containing collagen associated protein
    • AI181842
    • AI747162
    • Beta ig
    • Beta ig h3
    • Beta ig-h3
    • BGH3_HUMAN
    • Big h3
    • BIGH3
    • CDB1
    • CDG2
    • CDGG1
    • CSD
    • CSD1
    • CSD2
    • CSD3
    • EBMD
    • Kerato epithelin
    • Kerato-epithelin
    • LCD1
    • MGC150270
    • RGD CAP
    • RGD-CAP
    • RGD-containing collagen-associated protein
    • TGFBI
    • TGFBI transforming growth factor, beta induced, 68kDa
    • Transforming growth factor beta induced protein ig h3
    • Transforming growth factor-beta-induced protein ig-h3
    see all
  • Function

    Binds to type I, II, and IV collagens. This adhesion protein may play an important role in cell-collagen interactions. In cartilage, may be involved in endochondral bone formation.
  • Tissue specificity

    Highly expressed in the corneal epithelium.
  • Involvement in disease

    Defects in TGFBI are the cause of epithelial basement membrane corneal dystrophy (EBMD) [MIM:121820]; also known as Cogan corneal dystrophy or map-dot-fingerprint type corneal dystrophy. EBMD is a bilateral anterior corneal dystrophy characterized by grayish epithelial fingerprint lines, geographic map-like lines, and dots (or microcysts) on slit-lamp examination. Pathologic studies show abnormal, redundant basement membrane and intraepithelial lacunae filled with cellular debris. Although this disorder usually is not considered to be inherited, families with autosomal dominant inheritance have been identified.
    Defects in TGFBI are the cause of corneal dystrophy Groenouw type 1 (CDGG1) [MIM:121900]; also known as corneal dystrophy granular type. Inheritance is autosomal dominant. Corneal dystrophies show progressive opacification of the cornea leading to severe visual handicap.
    Defects in TGFBI are the cause of corneal dystrophy lattice type 1 (CDL1) [MIM:122200]. Inheritance is autosomal dominant.
    Defects in TGFBI are a cause of corneal dystrophy Thiel-Behnke type (CDTB) [MIM:602082]; also known as corneal dystrophy of Bowman layer type 2 (CDB2).
    Defects in TGFBI are the cause of Reis-Buecklers corneal dystrophy (CDRB) [MIM:608470]; also known as corneal dystrophy of Bowman layer type 1 (CDB1).
    Defects in TGFBI are the cause of lattice corneal dystrophy type 3A (CDL3A) [MIM:608471]. CDL3A clinically resembles to lattice corneal dystrophy type 3, but differs in that its age of onset is 70 to 90 years. It has an autosomal dominant inheritance pattern.
    Defects in TGFBI are the cause of Avellino corneal dystrophy (ACD) [MIM:607541]. ACD could be considered a variant of granular dystrophy with a significant amyloidogenic tendency. Inheritance is autosomal dominant.
  • Sequence similarities

    Contains 1 EMI domain.
    Contains 4 FAS1 domains.
  • Post-translational
    modifications

    Gamma-carboxyglutamate residues are formed by vitamin K dependent carboxylation. These residues are essential for the binding of calcium.
  • Cellular localization

    Secreted > extracellular space > extracellular matrix. May be associated both with microfibrils and with the cell surface.
  • Target information above from: UniProt accession Q15582 The UniProt Consortium
    The Universal Protein Resource (UniProt) in 2010
    Nucleic Acids Res. 38:D142-D148 (2010) .

    Information by UniProt

Images

  • SDS-PAGE - Recombinant Human TGFBI protein (ab86218)
    SDS-PAGE - Recombinant Human TGFBI protein (ab86218)
    15% SDS Page analysis of ab86218

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Alternative products to Recombinant Human TGFBI protein (ab86218)

  •  
  • Product image

    Recombinant Human TGFBI protein (ab86989)

    Applications: SDS-PAGE

  •  
  • Product image

    Recombinant Human TGFBI protein (ab51281)

    Applications: SDS-PAGE

Get resources and offers direct to your inbox Sign up
© 2021 Astana Biomed Group LLP. All rights reserved.